Ochotona princeps (American pika): 101530437 Help Entry 101530437         CDS       T07609                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism opi  Ochotona princeps (American pika) Pathway opi01522   Endocrine resistance opi04110   Cell cycle opi04115   p53 signaling pathway opi04151   PI3K-Akt signaling pathway opi04218   Cellular senescence opi04530   Tight junction opi04660   T cell receptor signaling pathway opi04933   AGE-RAGE signaling pathway in diabetic complications opi04934   Cushing syndrome opi05160   Hepatitis C opi05162   Measles opi05163   Human cytomegalovirus infection opi05164   Influenza A opi05165   Human papillomavirus infection opi05166   Human T-cell leukemia virus 1 infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05169   Epstein-Barr virus infection opi05200   Pathways in cancer opi05203   Viral carcinogenesis opi05212   Pancreatic cancer opi05214   Glioma opi05218   Melanoma opi05219   Bladder cancer opi05220   Chronic myeloid leukemia opi05222   Small cell lung cancer opi05223   Non-small cell lung cancer opi05224   Breast cancer opi05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     101530437 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101530437 (CDK4)    04115 p53 signaling pathway     101530437 (CDK4)    04218 Cellular senescence     101530437 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     101530437 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     101530437 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101530437 (CDK4)    05203 Viral carcinogenesis     101530437 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     101530437 (CDK4)    05225 Hepatocellular carcinoma     101530437 (CDK4)    05214 Glioma     101530437 (CDK4)    05220 Chronic myeloid leukemia     101530437 (CDK4)    05218 Melanoma     101530437 (CDK4)    05219 Bladder cancer     101530437 (CDK4)    05224 Breast cancer     101530437 (CDK4)    05222 Small cell lung cancer     101530437 (CDK4)    05223 Non-small cell lung cancer     101530437 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101530437 (CDK4)    05160 Hepatitis C     101530437 (CDK4)    05164 Influenza A     101530437 (CDK4)    05162 Measles     101530437 (CDK4)    05163 Human cytomegalovirus infection     101530437 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     101530437 (CDK4)    05169 Epstein-Barr virus infection     101530437 (CDK4)    05165 Human papillomavirus infection     101530437 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101530437 (CDK4)    04934 Cushing syndrome     101530437 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101530437 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:opi01001]     101530437 (CDK4) Enzymes [BR:opi01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      101530437 (CDK4) Protein kinases [BR:opi01001]  Serine/threonine kinases: CMGC group   CDK family    101530437 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like Motif Other DBs NCBI-GeneID:  101530437 NCBI-ProteinID:  XP_004583032 LinkDB All DBs Position 4:complement(18883601..18885514) Genome browser AA seq 304 aa AA seqDB search MAVSRYEPVAEIGVGAYGTVYKARDPLSGHFVALKSLRVPSEATPGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIRVTLVFEHVEQDLRAYLNKAPPPGLPVETIKDL MRQFLRGLDFLHSNCIIHRDLKPENILVTNSGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSAYATPVDLWSVGCIFAEMFRRKPLFCGNSEPDQLSKIFDLIGLPPEEDWPR EVSLPRSAFSPQGPRPVQSVVPELEESGAQLLLEMLTFSPHKRISACKALQHSYLRKEED NDPE NT seq 915 nt NT seq  +upstreamnt  +downstreamnt atggctgtctctcgatatgagccggtggccgaaattggcgtgggggcctatgggaccgtg tacaaggcccgggatcctctcagtggccactttgtggccctgaagagcctgcgtgtcccc agtgaagcgacaccgggagggggccttcccatcagcactgttcgggaggtggctttactg aggaggctggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccacc tctcgaactgaccgggagatcagggtgaccctggtgtttgagcacgtggagcaggactta agggcgtacctgaacaaggcacctccaccgggcttgccagtagagaccatcaaggatctg atgcggcagtttctgagaggcctggacttcctccactccaactgcatcattcaccgagac ttgaagccagagaacatcctggtgacaaacagcggcaccgtcaagctggctgactttggc ctggcccgaatctacagctaccagatggcactgacacctgtggtggtgacactctggtac cgtgctcctgaggtgctcctgcagtctgcttatgccacgcctgtggacctgtggagcgtc ggctgtatcttcgcagagatgtttcggcgaaagcccctcttctgtggaaactctgaacct gaccagttaagcaagatttttgacctgattggattgcccccagaagaggactggccccga gaggtgtcccttccccgaagtgccttttccccgcaagggccccgcccagtgcagtcagtg gtgcctgagctggaggagtccggagcacaactgctactggagatgctgactttcagccca cacaagcgaatctcggcctgcaaagccctacagcactcttacctccgtaaggaagaggac aacgacccagagtga

DBGET integrated database retrieval system