Ochotona princeps (American pika): 101533318 Help Entry 101533318         CDS       T07609                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism opi  Ochotona princeps (American pika) Pathway opi04060   Cytokine-cytokine receptor interaction opi04151   PI3K-Akt signaling pathway opi04217   Necroptosis opi04380   Osteoclast differentiation opi04620   Toll-like receptor signaling pathway opi04621   NOD-like receptor signaling pathway opi04622   RIG-I-like receptor signaling pathway opi04623   Cytosolic DNA-sensing pathway opi04630   JAK-STAT signaling pathway opi04650   Natural killer cell mediated cytotoxicity opi04668   TNF signaling pathway opi04936   Alcoholic liver disease opi05135   Yersinia infection opi05142   Chagas disease opi05152   Tuberculosis opi05160   Hepatitis C opi05161   Hepatitis B opi05162   Measles opi05163   Human cytomegalovirus infection opi05164   Influenza A opi05165   Human papillomavirus infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05168   Herpes simplex virus 1 infection opi05169   Epstein-Barr virus infection opi05170   Human immunodeficiency virus 1 infection opi05171   Coronavirus disease - COVID-19 opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101533318 (IFNB1)    04668 TNF signaling pathway     101533318 (IFNB1)    04151 PI3K-Akt signaling pathway     101533318 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101533318 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101533318 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101533318 (IFNB1)    04621 NOD-like receptor signaling pathway     101533318 (IFNB1)    04622 RIG-I-like receptor signaling pathway     101533318 (IFNB1)    04623 Cytosolic DNA-sensing pathway     101533318 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     101533318 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     101533318 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101533318 (IFNB1)    05161 Hepatitis B     101533318 (IFNB1)    05160 Hepatitis C     101533318 (IFNB1)    05171 Coronavirus disease - COVID-19     101533318 (IFNB1)    05164 Influenza A     101533318 (IFNB1)    05162 Measles     101533318 (IFNB1)    05168 Herpes simplex virus 1 infection     101533318 (IFNB1)    05163 Human cytomegalovirus infection     101533318 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     101533318 (IFNB1)    05169 Epstein-Barr virus infection     101533318 (IFNB1)    05165 Human papillomavirus infection     101533318 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     101533318 (IFNB1)    05152 Tuberculosis     101533318 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     101533318 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101533318 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101533318 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:opi04052]     101533318 (IFNB1) Cytokines and neuropeptides [BR:opi04052]  Cytokines   Interferons    101533318 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon TMEM127 Motif Other DBs NCBI-GeneID:  101533318 NCBI-ProteinID:  XP_004581293 LinkDB All DBs Position 1A:43405700..43406245 Genome browser AA seq 181 aa AA seqDB search MVNRCILQIVLLMCFSSIALPMSYNSLQIQLHNSSQRCLDLLRELKGQTEDCLNERMNFM IPKEIRKPQQLRKEDATLIIFEMLKNTFVIFGKNVSSTGWNETLVQHFRSETYWQICHLK NMSKTFTKKNSMLHLRLKNYYWKILNFLEEKKYSNCAWKLVHLQIIKDFANMRNLIDSFQ N NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggtcaacaggtgtattcttcaaatcgttctcctgatgtgcttctccagcatagctctt cccatgagctacaactcgcttcaaatccaactgcacaacagcagtcagaggtgcttggac ctcctgagggagctaaagggacagactgaggactgcctcaatgaaaggatgaacttcatg attcccaaggagatcaggaagccccaacagctccgcaaagaagatgctaccttgatcatc tttgaaatgctcaagaatacctttgtgattttcggaaaaaatgtctccagcactggctgg aatgagactcttgttcaacactttcgctctgaaacctattggcagatttgccatctgaag aacatgagcaaaacgttcaccaagaaaaacagtatgttacatctacgcctgaagaactat tactggaagatcttgaatttcctggaggaaaagaagtacagcaactgtgcctggaaatta gtccatttgcaaatcatcaaggactttgccaacatgcgcaatctcatagattccttccaa aactga

DBGET integrated database retrieval system