Ochotona princeps (American pika): 101535976 Help Entry 101535976         CDS       T07609                                  Symbol IKBKG Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism opi  Ochotona princeps (American pika) Pathway opi01523   Antifolate resistance opi04010   MAPK signaling pathway opi04014   Ras signaling pathway opi04062   Chemokine signaling pathway opi04064   NF-kappa B signaling pathway opi04151   PI3K-Akt signaling pathway opi04210   Apoptosis opi04380   Osteoclast differentiation opi04620   Toll-like receptor signaling pathway opi04621   NOD-like receptor signaling pathway opi04622   RIG-I-like receptor signaling pathway opi04623   Cytosolic DNA-sensing pathway opi04625   C-type lectin receptor signaling pathway opi04657   IL-17 signaling pathway opi04658   Th1 and Th2 cell differentiation opi04659   Th17 cell differentiation opi04660   T cell receptor signaling pathway opi04662   B cell receptor signaling pathway opi04668   TNF signaling pathway opi04920   Adipocytokine signaling pathway opi04936   Alcoholic liver disease opi05010   Alzheimer disease opi05132   Salmonella infection opi05135   Yersinia infection opi05142   Chagas disease opi05145   Toxoplasmosis opi05160   Hepatitis C opi05161   Hepatitis B opi05162   Measles opi05163   Human cytomegalovirus infection opi05164   Influenza A opi05165   Human papillomavirus infection opi05166   Human T-cell leukemia virus 1 infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05168   Herpes simplex virus 1 infection opi05169   Epstein-Barr virus infection opi05170   Human immunodeficiency virus 1 infection opi05171   Coronavirus disease - COVID-19 opi05200   Pathways in cancer opi05203   Viral carcinogenesis opi05208   Chemical carcinogenesis - reactive oxygen species opi05212   Pancreatic cancer opi05215   Prostate cancer opi05220   Chronic myeloid leukemia opi05221   Acute myeloid leukemia opi05222   Small cell lung cancer opi05235   PD-L1 expression and PD-1 checkpoint pathway in cancer opi05340   Primary immunodeficiency opi05417   Lipid and atherosclerosis opi05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101535976 (IKBKG)    04014 Ras signaling pathway     101535976 (IKBKG)    04064 NF-kappa B signaling pathway     101535976 (IKBKG)    04668 TNF signaling pathway     101535976 (IKBKG)    04151 PI3K-Akt signaling pathway     101535976 (IKBKG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101535976 (IKBKG)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101535976 (IKBKG)    04621 NOD-like receptor signaling pathway     101535976 (IKBKG)    04622 RIG-I-like receptor signaling pathway     101535976 (IKBKG)    04623 Cytosolic DNA-sensing pathway     101535976 (IKBKG)    04625 C-type lectin receptor signaling pathway     101535976 (IKBKG)    04660 T cell receptor signaling pathway     101535976 (IKBKG)    04658 Th1 and Th2 cell differentiation     101535976 (IKBKG)    04659 Th17 cell differentiation     101535976 (IKBKG)    04657 IL-17 signaling pathway     101535976 (IKBKG)    04662 B cell receptor signaling pathway     101535976 (IKBKG)    04062 Chemokine signaling pathway     101535976 (IKBKG)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101535976 (IKBKG)   09158 Development and regeneration    04380 Osteoclast differentiation     101535976 (IKBKG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101535976 (IKBKG)    05208 Chemical carcinogenesis - reactive oxygen species     101535976 (IKBKG)    05203 Viral carcinogenesis     101535976 (IKBKG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101535976 (IKBKG)   09162 Cancer: specific types    05212 Pancreatic cancer     101535976 (IKBKG)    05221 Acute myeloid leukemia     101535976 (IKBKG)    05220 Chronic myeloid leukemia     101535976 (IKBKG)    05215 Prostate cancer     101535976 (IKBKG)    05222 Small cell lung cancer     101535976 (IKBKG)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101535976 (IKBKG)    05170 Human immunodeficiency virus 1 infection     101535976 (IKBKG)    05161 Hepatitis B     101535976 (IKBKG)    05160 Hepatitis C     101535976 (IKBKG)    05171 Coronavirus disease - COVID-19     101535976 (IKBKG)    05164 Influenza A     101535976 (IKBKG)    05162 Measles     101535976 (IKBKG)    05168 Herpes simplex virus 1 infection     101535976 (IKBKG)    05163 Human cytomegalovirus infection     101535976 (IKBKG)    05167 Kaposi sarcoma-associated herpesvirus infection     101535976 (IKBKG)    05169 Epstein-Barr virus infection     101535976 (IKBKG)    05165 Human papillomavirus infection     101535976 (IKBKG)   09171 Infectious disease: bacterial    05132 Salmonella infection     101535976 (IKBKG)    05135 Yersinia infection     101535976 (IKBKG)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101535976 (IKBKG)    05142 Chagas disease     101535976 (IKBKG)   09163 Immune disease    05340 Primary immunodeficiency     101535976 (IKBKG)   09164 Neurodegenerative disease    05010 Alzheimer disease     101535976 (IKBKG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101535976 (IKBKG)    05418 Fluid shear stress and atherosclerosis     101535976 (IKBKG)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101535976 (IKBKG)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     101535976 (IKBKG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:opi01001]     101535976 (IKBKG) Protein kinases [BR:opi01001]  Serine/threonine kinases: Other   IKK family [OT]    101535976 (IKBKG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CC2-LZ NEMO zf_C2H2_10 LLC1 Motif Other DBs NCBI-GeneID:  101535976 NCBI-ProteinID:  XP_036354262 LinkDB All DBs Position Unknown AA seq 546 aa AA seqDB search MSGGAGMVASEAGCPGHPPYFLRISTFTSGFHGYDTGNRKRACDSGEGKGDRSPGTVLEL GTSRSSPSPMDPAGGAAPSPPLGRTSSLPLHTGPSRERDHSLPAYTLASPLARHATEPSS APSTLTWLSRRPWRSPLCEMVQPSGGPAGEQDVLPEESSLGKPAMLHLPAEQSTPDTLQR CLEENQELREAIRQSNQMLRERCEELLRFQVSQREEKEFLLGKFQEARRLVERLNLEKLD LQRQREQALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGR ARAASEQARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVA YHQLFQDYDNHIKNSMVSGERKRGMQLEDLKQQLRQAEEALVAKQEVIDKLKEEAEQHKM VMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESSRI EDMRKRHVEVAQSVLPPPSAHHSFHLTLTNQRRSPPEEPPDFCCPKCQYRAPDMDTLQIH VMECIE NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt atgtcgggaggggcggggatggtggcgtcggaagctggctgcccggggcatccgccctac tttctcaggatatcgacttttacttccggattccatggctacgacaccggaaaccggaag agggcttgcgacagcggagagggcaagggcgaccgctcgcccgggaccgtcttggagctc gggacttctcggagctctcccagcccgatggaccccgccggcggggcggcaccgtcgccg ccactcggccgcacgtccagcttgccgctccacacgggccccagccgggagcgcgaccac agcctgcctgcttacacccttgccagccctctagcccgccacgccaccgagccttcctct gcccctagcaccctgacttggctgagcagacgcccttggaggagtccactgtgtgagatg gtgcagcccagtggtggcccagccggggagcaggacgtgctgcctgaagagtcatcgctg gggaaaccggccatgctgcacctgcctgcggaacagagcacccctgacactctacagcgc tgtctggaggagaatcaagaactccgagaggctatccggcagagcaaccagatgctgcgg gaacgctgtgaggagctgctccgcttccaagtcagccagagggaggagaaggagttcctc ctgggcaagttccaggaggccaggaggctggtggagaggctcaacctggagaagctcgac cttcagaggcagagggagcaggccctgcaggaggtggagcacctcaagagatgtcagcag cagatggccgaggataaggcctccgtgaaagctcaagtgacatccttgctaggggagctg caggagagccagagtcgcttggaggctgccaccaaggagcggcaggctctggagggcagg gcccgtgcagccagtgagcaggcccggcagctggagagcgagcgggaggcgctgcagcag cagcacagtgtgcaggtggaccagctgcgcatgcagagccagagtgtggaggctgcgctg cgcatggagcgccaggctgcctccgaggagaagcggaagctggcccagttgcaggtggcc tatcaccagctcttccaggactatgacaaccacatcaagaacagcatggtgagcggcgag cgcaagcggggcatgcagctggaggatcttaagcagcagctccggcaggccgaggaggcc ctggtggccaagcaggaagtgattgacaaattgaaggaggaggccgagcagcacaagatg gtgatggagactgtgccggtcctgaaggcccaggcggatatctacaaggctgacttccag gctgagaggcaggccagggagaagctggctgaaaagaaggagctgctgcaagagcagctg gagcagctgcagcgagagtacagcaagctgaaggccagctgtcaggagtcctccaggatc gaggatatgaggaagcggcatgttgaggtcgcccagtccgtcttaccacccccctcagcc caccactccttccatctgacgctgaccaaccagagaagaagccccccagaagagcctcct gacttctgttgtcctaagtgccagtatcgggctcctgacatggacaccctgcagatccac gtcatggagtgcattgagtag

DBGET integrated database retrieval system