KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275791
Entry
107275791         CDS       T01015                                 
Name
(RefSeq) cystathionine beta-lyase, chloroplastic-like
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107275791
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107275791
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     107275791
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 GDC-P Beta_elim_lyase
Other DBs
NCBI-GeneID: 107275791
NCBI-ProteinID: XP_015641512
UniProt: A0A0P0WT28
LinkDB
Position
6:3861472..3865453
AA seq 384 aa
MKEPSVATILTSFENSFDGFGSMSTPLYQTATFKQPSATDNGPYDYTRSGNPTRDVLQSL
MAKLEKADQAFCFTSGMAALAAVTHLLKSGQEIVAGEDIYGGSDRLLSQVAPRHGIVVKR
IDTTKISEVTSAIGPLTKLVWLESPTNPRLQITDIKKIAEIAHYHGALVLVDNSIMSPVL
SRPLELGADIVMHSATKFIAGHSDLMAGILAVKGESSLAKEIAFLQNAEGSGLAPFDCWL
CLRGIKTMALRVEKQQANAQKIAEFLASHPRVKKVNYAGLPDHPGRSLHYSQAKGAGSVL
SFLTGSLALSKHVVETTKYFNVTVSFGSVKSLISLPCFMSHASIPSAVREERGLTDDLVR
ISVGIEDADDLIADLDHALRSGPA
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaaggagcctagcgtggcgacgatactgacgagcttcgagaactcgttcgatgggttc
gggtctatgagcacgccgctgtaccagacggccacgtttaagcagccttcagcaaccgat
aatggaccttatgattacactagaagtggtaaccctacacgtgatgttctccaaagcctt
atggctaagcttgagaaggcggatcaggcattctgcttcaccagtgggatggcagcacta
gctgcagtaacacacctccttaagtctggacaagaaatagttgctggagaggacatatat
ggtggctcagaccgtctgctctcacaagttgccccgagacatgggattgtagtaaaacga
attgatacaaccaaaattagtgaggtaacttctgcaattgggcccttgactaaactagta
tggcttgaaagtcccaccaatccccgtctacaaattactgatataaagaaaatagcagag
atagctcattaccatggtgctcttgttttagtagacaacagcatcatgtctcctgtgctc
tcccgtcctctagaacttggagcagatattgttatgcactcagcaaccaaatttatagct
ggacatagcgatcttatggctggaattcttgcggtgaagggtgaaagcagcttggctaaa
gagattgcatttctacaaaatgctgaaggatcaggtttggcaccatttgattgctggctt
tgtttgagaggaatcaaaaccatggctttgcgggtggagaagcagcaggctaatgctcag
aagattgctgaatttctagcttctcatccaagagtaaagaaagtgaactatgcaggactt
cctgatcatcctggacgatctctacactattcccaggcaaagggagcgggttcagttctc
agtttcctaactggttcattagctctctcaaaacatgttgttgagaccacaaagtacttc
aatgtaacagttagctttggaagtgtgaaatcgctcattagcctgccatgcttcatgtca
cacgccagcatcccttctgcggttcgcgaggagcgcggcctgacagacgatctagtcagg
atatcggttggaattgaggatgccgacgacctcatagcggatcttgatcatgctctccgg
tctggtccagcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340283
Entry
4340283           CDS       T01015                                 
Name
(RefSeq) cystathionine beta-lyase, chloroplastic isoform X1
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4340283
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4340283
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     4340283
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 GDC-P Beta_elim_lyase
Other DBs
NCBI-GeneID: 4340283
NCBI-ProteinID: XP_015641397
LinkDB
Position
6:3823012..3827397
AA seq 476 aa
MSAAAAAAAAAAIPTSLGRLFHLRPTPNPSRNLSGSSAQPLLRLSYHPRLTLSRRMEAPA
AIADSHGGGDLSASAVGAEALGAVAAPDFDVEMKEPSVATILTSFENSFDGFGSMSTPLY
QTATFKQPSATDNGPYDYTRSGNPTRDVLQSLMAKLEKADQAFCFTSGMAALAAVTHLLK
SGQEIVAGEDIYGGSDRLLSQVAPRHGIVVKRIDTTKISEVTSAIGPLTKLVWLESPTNP
RLQITDIKKIAEIAHYHGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDLMAG
ILAVKGESSLAKEIAFLQNAEGSGLAPFDCWLCLRGIKTMALRVEKQQANAQKIAEFLAS
HPRVKKVNYAGLPDHPGRSLHYSQAKGAGSVLSFLTGSLALSKHVVETTKYFNVTVSFGS
VKSLISLPCFMSHASIPSAVREERGLTDDLVRISVGIEDADDLIADLDHALRSGPA
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgagcgccgccgccgccgccgccgccgccgccgcaatccccacctctctcggccgcctc
ttccacctccgccccaccccgaacccctcccggaaccttagcggcagctcagcgcaaccc
ctcctccgcctcagctaccacccacgcctcacgctctctcgccgcatggaggcgccggcg
gcgatcgccgactcccacggcggcggcgacctgagcgcgtccgcggtcggcgcggaggcg
ctgggcgccgtcgccgctccggatttcgatgtggagatgaaggagcctagcgtggcgacg
atactgacgagcttcgagaactcgttcgatgggttcgggtctatgagcacgccgctgtac
cagacggccacgtttaagcagccttcagcaaccgataatggaccttatgattacactaga
agtggtaaccctacacgtgatgttctccaaagccttatggctaagcttgagaaggcggat
caggcattctgcttcaccagtgggatggcagcactagctgcagtaacacacctccttaag
tctggacaagaaatagttgctggagaggacatatatggtggctcagaccgtctgctctca
caagttgccccgagacatgggattgtagtaaaacgaattgatacaaccaaaattagtgag
gtaacttctgcaattgggcccttgactaaactagtatggcttgaaagtcccaccaatccc
cgtctacaaattactgatataaagaaaatagcagagatagctcattaccatggtgctctt
gttttagtagacaacagcatcatgtctcctgtgctctcccgtcctctagaacttggagca
gatattgttatgcactcagcaaccaaatttatagctggacatagcgatcttatggctgga
attcttgcggtgaagggtgaaagcagcttggctaaagagattgcatttctacaaaatgct
gaaggatcaggtttggcaccatttgattgctggctttgtttgagaggaatcaaaaccatg
gctttgcgggtggagaagcagcaggctaatgctcagaagattgctgaatttctagcttct
catccaagagtaaagaaagtgaactatgcaggacttcctgatcatcctggacgatctcta
cactattcccaggcaaagggagcgggttcagttctcagtttcctaactggttcattagct
ctctcaaaacatgttgttgagaccacaaagtacttcaatgtaacagttagctttggaagt
gtgaaatcgctcattagcctgccatgcttcatgtcacacgccagcatcccttctgcggtt
cgcgaggagcgcggcctgacagacgatctagtcaggatatcggttggaattgaggatgcc
gacgacctcatagcggatcttgatcatgctctccggtctggtccagcttag

DBGET integrated database retrieval system