KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324118
Entry
4324118           CDS       T01015                                 
Name
(RefSeq) methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00670  One carbon pool by folate
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4324118
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4324118
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     4324118
SSDB
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Other DBs
NCBI-GeneID: 4324118
NCBI-ProteinID: XP_015622378
UniProt: A0A0P0V6V5 Q5N7L5
LinkDB
Position
1:28363991..28367989
AA seq 362 aa
MARCSPPLLRRLFCRAAKSASAAGAGTGGTSKKNIVFLGSPQVAASVLETLLVASESPDS
SFQVSAVVTQPPAAKNRGRKLMPSAVAQLALDRGFPGDLIFTPERAGEEAFLSDLKEVRP
ELCITAAYGNILPQRFLDIPPYGTVNIHPSLLPLYRGAAPVQRALQDGVEETGVSLAYTV
RALDAGPVIASEKFAVDEYIKAPELLAILFNLGSKLLLHELPSILDGTAKEKAKPQDDSK
ITHAPKLNSDESWLSFNQEAKLLHNKVRAFAGWPGTRAKLQLVNQNGEPDVLEIKVISTK
ACASCDKTGDGNEVLFSGNSLLIPCGGSSCLEVVELQLPGKKVTTARDFWNGLRGQRLLK
SP
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcgcgctgctccccgccgctgctgcgccgcctcttctgccgcgccgccaaatccgcc
tccgccgccggcgccggcaccggcggcactagcaagaagaatatcgtcttcttgggctcc
ccccaggtagccgcctccgtcctggaaactttgctggtggcgtcggagtcgccggactcc
tcattccaggtttccgccgtcgtgacgcagccgccggccgccaagaaccgggggaggaag
ctgatgccgtcggccgtcgcgcagctcgcgctcgaccgcgggttccccggcgacctcatc
ttcaccccggagcgcgctggagaggaggcgtttctgtcagacctgaaggaggtgagacca
gagctctgcatcactgctgcctatggaaacattctgcctcagaggtttcttgatatcccg
ccttatggaactgttaacatacacccgagtttgctgcctctatatcgtggtgcagcacct
gtgcagagggcattgcaggacggtgttgaagaaacaggtgtttcccttgcatatactgtc
cgtgccttggatgcgggtccagttattgcttctgaaaagtttgctgtagatgagtatatt
aaggcaccggagctgcttgctatattgttcaacttaggatccaagctattgcttcatgaa
ctaccctctattcttgatggaacggctaaagaaaaggcaaaaccacaagatgactccaaa
attacacatgcaccgaagctgaattctgatgagtcatggttgtcattcaaccaagaagct
aaattgctccataacaaggtacgagcctttgcaggttggccaggaactcgcgcaaagttg
cagcttgtgaaccaaaatggggaacccgatgtgcttgagattaaggttatcagcacgaag
gcttgcgcatcctgtgacaaaaccggagatggaaatgaggtactcttctcggggaactca
ttgctgattccttgcggtggatcatcttgtctcgaggtcgtggagcttcaactccctgga
aagaaggtgacgacagcaagggacttctggaatggtttgcgtggtcagaggctgctgaaa
tcaccatag

DBGET integrated database retrieval system