KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324261
Entry
4324261           CDS       T01015                                 
Name
(RefSeq) histidine biosynthesis bifunctional protein hisIE, chloroplastic isoform X1
  KO
K11755  phosphoribosyl-AMP cyclohydrolase / phosphoribosyl-ATP pyrophosphohydrolase [EC:3.5.4.19 3.6.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00340  Histidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    4324261
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     4324261
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     4324261
SSDB
Motif
Pfam: PRA-CH PRA-PH MazG
Other DBs
NCBI-GeneID: 4324261
NCBI-ProteinID: XP_015611206
UniProt: Q5NBQ1 A0A8J8XTG4
LinkDB
Position
1:complement(9684835..9689522)
AA seq 306 aa
MAAPPLPRAPVSSSAAAASPGGRALLLLRVGGGGSGRCAGVAAAAAPGWRRPFPAASVAA
RSAGTTPGEVAVDPKVEAILDSVKWDSKGLAVAIAQNVDTGAILMQGFANKEALATTIST
RKATFYSRSRSSLWTKGETSMNFINVHDIFLDCDRDSIIYLGKPDGPTCHTGAETCYYTS
VYDALQGSKPNQDRQVVSTLYSLEDTISRRKEEIVTEGSGKPSWTKKLILDNRLLCSKIS
EEAGELNQTLLENEDESRTISEMGDLLYHAMVLLRVKGVRMEQVLEVLRKRFSQSGIEEK
ASRNKS
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcggcgcctccgcttccccgcgcccccgtctcctcctccgccgccgccgcgtcgccg
gggggccgcgctctcctcctcctccgcgtcggcggaggaggttccggaagatgcgctggc
gtggcggcggcggcggcaccgggttggcggcggccgttcccggctgcctccgtcgcggcg
cgctcggctggtaccacgccgggagaggtcgccgtcgatcctaaggtcgaagcaatacta
gacagtgtgaagtgggacagtaaaggcttggctgttgctattgcccaaaatgtggatact
ggagccattctcatgcagggttttgccaacaaagaagcccttgcaacaactatatcaacc
aggaaagctacattctatagccgttcacggtcttcattgtggacaaaaggggagacatca
atgaatttcatcaatgtgcatgacattttcttggactgtgaccgtgattctataatatac
cttgggaagccagatgggcctacttgccatacaggggcagagacttgttactatacttca
gtctatgatgctctacaaggttcgaagcccaatcaagataggcaggttgtctcaactctg
tactcacttgaagatacaattagtagacggaaggaagagatagttactgaaggaagtggc
aagccatcatggacaaaaaaactaatacttgataaccggctgctttgctcaaaaataagc
gaagaagctggagagctaaaccaaacactgcttgagaacgaggacgagagccgcacaatc
agtgagatgggtgatttgctataccacgcgatggtgctgcttagggtcaagggcgtgagg
atggaacaggtcttggaggtcctcaggaagcgattctcgcagtctggtattgaggagaag
gccagtcgcaacaaatcttag

DBGET integrated database retrieval system