KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325074
Entry
4325074           CDS       T01015                                 
Name
(RefSeq) sm-like protein LSM3A
  KO
K12622  U6 snRNA-associated Sm-like protein LSm3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4325074
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4325074
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4325074
   03041 Spliceosome [BR:osa03041]
    4325074
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4325074
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4325074
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4325074
 Complex C
  U2 snRNP components
    4325074
SSDB
Motif
Pfam: LSM TIG_SUH
Other DBs
NCBI-GeneID: 4325074
NCBI-ProteinID: XP_015641494
UniProt: Q5N9F1 A0A0P0VAW1
LinkDB
Position
1:complement(37527408..37529159)
AA seq 104 aa
MAAAAAAAAAEEEIAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVE
EIVTTVEIDDETYEEIVRTTKRTIPFLFVRGDGVILVSPPLRTA
NT seq 315 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcagcggcggctgaggaggagatcgcggtgaaggagccgctg
gatctgatcaggctcagcctcgacgagcgcatctacgtcaagctcaggtccgaccgcgag
ctccgcggcaagctccatgcatacgatcaacatttaaacatgattcttggagatgttgag
gagatcgtgacaacagttgagattgacgatgagacatatgaagaaattgtgcgcaccaca
aaacgcactatccccttcctttttgttcgaggtgatggtgtcattttggtttctccaccc
ctccgaacggcatga

DBGET integrated database retrieval system