KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325211
Entry
4325211           CDS       T01015                                 
Name
(RefSeq) triosephosphate isomerase, cytosolic
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00562  Inositol phosphate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4325211
   00051 Fructose and mannose metabolism
    4325211
   00562 Inositol phosphate metabolism
    4325211
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4325211
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4325211
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     4325211
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4325211
  Exosomal proteins of bladder cancer cells
   4325211
  Exosomal proteins of melanoma cells
   4325211
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-GeneID: 4325211
NCBI-ProteinID: XP_015621507
UniProt: P48494
LinkDB
Position
1:complement(2589773..2593636)
AA seq 253 aa
MGRKFFVGGNWKCNGTTDQVDKIVKILNEGQIASTDVVEVVVSPPYVFLPVVKSQLRPEI
QVAAQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRSLLGESNEFVGDKVAYALSQ
GLKVIACVGETLEQRESGSTMDVVAAQTKAISERIKDWTNVVVAYEPVWAIGTGKVATPD
QAQEVHDGLRKWLAANVSAEVAESTRIIYGGSVTGANCKELAAKPDVDGFLVGGASLKPE
FIDIINSATVKSA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgggccgcaagttcttcgttggtggcaactggaaatgcaacgggaccactgatcaggtg
gacaaaattgtgaaaattctgaatgagggacagattgcttctacagatgttgttgaggtg
gttgtcagcccaccttatgtgttccttcccgtggtcaagagtcagctgcgcccggagatc
caagttgctgctcagaattgttgggtgaagaagggcggggctttcaccggtgaggtcagc
gctgagatgcttgtcaaccttagtattccctgggttattcttggacactctgaaaggagg
agtttgttgggtgaatcaaatgagtttgttggagacaaagtggcatatgcgctctctcag
ggcttgaaggtcattgcatgtgttggtgagactctcgagcagcgggaatctggttcgacc
atggatgttgttgctgcacaaacaaaagcaatttctgaaaggatcaaggattggactaat
gtggttgttgcctatgaacctgtgtgggccattggaactggtaaagttgctacaccagat
caagcacaagaagtgcatgatggcctgaggaagtggctcgctgctaatgtcagtgcagag
gttgctgaatcaacaaggatcatctatggaggttccgtaactggtgcgaactgcaaggag
ctggcagcaaagcctgatgttgatggttttctcgtcggtggtgcttcattgaagcctgaa
ttcatcgacatcatcaactccgccaccgtgaagtccgcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327400
Entry
4327400           CDS       T01015                                 
Name
(RefSeq) triosephosphate isomerase, cytosolic-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00562  Inositol phosphate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327400
   00051 Fructose and mannose metabolism
    4327400
   00562 Inositol phosphate metabolism
    4327400
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4327400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327400
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     4327400
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4327400
  Exosomal proteins of bladder cancer cells
   4327400
  Exosomal proteins of melanoma cells
   4327400
SSDB
Motif
Pfam: TIM AP_endonuc_2 DUF6137
Other DBs
NCBI-GeneID: 4327400
NCBI-ProteinID: XP_015616508
UniProt: Q8LR75 A0A0N7KE16
LinkDB
Position
1:36129300..36132660
AA seq 255 aa
MAARKFFVGGNWKCNGTGEDVKKIVTVLNEAEVPSEDVVEVVVSPPFVFLPQVKGLLRPD
FSVAAQNCWVRKGGAFTGEISAEMLVNLQVPWVILGHSERRALMGESSDFVADKIAYALS
QGIKVIACIGETLEQREAGTTMEVVAAQTKAIAEKISDWTNVVLAYEPVWAIGTGKVATP
AQAQEVHDGLRKWLVTNVSPAVAESTRIIYRGSVNGANCKELAAKPDVDGFLVGGASLKP
EFVDIIKSATVKSSA
NT seq 768 nt   +upstreamnt  +downstreamnt
atggctgccaggaagttcttcgtcggcggcaactggaaatgcaatgggacaggggaggac
gtgaagaagatcgtcaccgtcctcaacgaggccgaggtgccctccgaggacgtcgtcgag
gtggtggtgagcccgccgttcgtgttcctgccgcaggtgaagggtttgctccggccggac
ttctccgtcgccgcgcagaattgctgggtgcgcaagggcggcgccttcactggcgagatc
agtgccgagatgttggtgaacctgcaggtgccttgggtgattctgggacactctgagcgg
agagcgctgatgggcgaatcaagtgattttgttgctgacaaaattgcgtacgcactttcc
caaggtatcaaggtaattgcttgcattggtgagacccttgaacagagagaagcaggaaca
acgatggaagttgttgcagcgcaaactaaagctattgcagagaagatatccgattggacc
aatgttgttttggcatatgaaccagtttgggccattggaaccggcaaggttgcaacccct
gctcaggctcaggaggttcatgatggtctgagaaagtggcttgtgactaatgttagtcct
gcagttgctgaatcaaccaggattatttacagaggctccgtaaatggagcaaactgcaaa
gaacttgctgctaaacctgatgttgatggattccttgttggaggagcttcattgaagcct
gaatttgtggacatcatcaagtctgctaccgtcaagtcttctgcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347691
Entry
4347691           CDS       T01015                                 
Name
(RefSeq) triosephosphate isomerase, chloroplastic
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00562  Inositol phosphate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4347691
   00051 Fructose and mannose metabolism
    4347691
   00562 Inositol phosphate metabolism
    4347691
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4347691
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4347691
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     4347691
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4347691
  Exosomal proteins of bladder cancer cells
   4347691
  Exosomal proteins of melanoma cells
   4347691
SSDB
Motif
Pfam: TIM CutC
Other DBs
NCBI-GeneID: 4347691
NCBI-ProteinID: XP_015612500
UniProt: A0A0N7KR63 Q69K00
LinkDB
Position
9:complement(21033115..21036501)
AA seq 304 aa
MAAPSSLASSHLSRLADLRRAGVAAAAPAHPQQLRLGCSRRRAQRVVAMAGSGKFFVGGN
WKCNGTKDSVSKLVTELNAATLEPDVDVVVAPPFIYIDQVKNSLTDRIEVSAQNVWIGKG
GAYTGEISAEQLVDIGCQWVILGHSERRHVIGEDDQFIGKKAAYALSQNVKVIACIGELL
EEREAGKTFDVCFKQMKAFADSITNWADVVIAYEPVWAIGTGKVATPEQAQEVHAAVRDW
LKTNVSPEVASGIRIIYGGSVNAANCAELAKKEDIDGFLVGGASLKGPDFATIINSVTSK
KVAA
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcggcgccgtcgtccctcgcgtcctcccacctctcccgcctcgccgacctccgccgc
gcaggcgtcgccgccgccgccccggcgcatccgcagcagctccgcctcgggtgctcccgc
cgccgcgcccagcgcgtcgtcgccatggccggatccggcaagttcttcgttggaggcaac
tggaagtgcaatggaacgaaggactctgtcagcaagcttgtgactgaattgaatgctgct
acacttgaacctgatgttgatgttgtggttgcaccaccattcatttatattgatcaggtt
aagaactcactaactgatcgtattgaggtatctgctcagaatgtttggattggaaaagga
ggagcatacactggagagatcagtgcggagcaattggtggacattggctgccaatgggtt
attcttgggcattcagagcgtagacatgtcattggtgaagatgatcagtttattgggaag
aaggctgcatatgccttgagtcaaaatgtaaaggttattgcctgcataggggagctgttg
gaagagagagaagcagggaaaacttttgacgtctgttttaagcagatgaaggcttttgca
gacagtattacaaactgggcggatgtagtaattgcatatgagcctgtttgggctattgga
accgggaaagttgctactcctgagcaagctcaggaagttcatgctgctgttcgtgattgg
ttgaaaaccaacgtgtcacctgaggttgcttccggcattcgaattatatatggaggttct
gtaaatgcagccaattgtgccgagctagcaaagaaagaagatattgacggcttccttgtt
ggtggtgcctctttgaagggtccggattttgccactattatcaactcggtgacttccaag
aaagttgcagcctga

DBGET integrated database retrieval system