KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325755
Entry
4325755           CDS       T01015                                 
Name
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4325755
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     4325755
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 NAD_Gly3P_dh_N PDH_N ApbA
Other DBs
NCBI-GeneID: 4325755
NCBI-ProteinID: XP_015610789
UniProt: Q8GT01
LinkDB
Position
1:complement(41718600..41721585)
AA seq 284 aa
MAAPPQPVPAPAAASPEVFRLGFIGPGNLAESIARGVAASGVLPATAIRTAPHRRPERAE
AFSSIGAHILETNAQVVDDSDVIVISVKPQIVRQVLVELKPLLSEEKLLVSIAAGIKMED
LQGWSGHRRFIRVMPNTPSAVGQAASVMCLGEMATENDENRVRSLFSAIGKVWTAEEKYF
DAVTGLSGSGPAYIFLAIEAMADGGVAAGLPRDLALGLASQTVLGAATMVNKTGKHPGQL
KDMVTSPAGTTITGIQELEKGAFRGTLINAVVAATKRCRELSQS
NT seq 855 nt   +upstreamnt  +downstreamnt
atggcggcgccgcctcagcccgtgccggcgcccgcggccgcgtcgccggaggtgttccgg
ctcgggttcatcggcccgggtaacctcgcggagagcatcgcccgcggcgtggcggcgtcg
ggcgtcctcccggccaccgcgatccgcaccgcgccacaccgccgccccgagcgcgccgag
gccttctcatccatcggagctcacatcttggagaccaacgcgcaggtagttgatgacagt
gacgtgatcgtcatctctgtgaagccgcagatcgtaaggcaggtactggttgagctaaaa
cccttgctgtcagaagaaaagcttctggtgtccattgctgctggcatcaagatggaagat
ctgcagggttggtctggtcatcgaagatttattagagtaatgccaaacaccccttcagct
gttggacaagcagcatcagtgatgtgtttgggggagatggctactgagaatgatgaaaac
cgtgtaagaagtttattcagtgccattggaaaagtttggacagctgaagaaaaatatttt
gatgctgtaactgggctaagtggtagtggcccggcttatattttcttagcaatagaggcc
atggctgatggtggagttgctgctggtcttcctcgggatcttgcacttggtcttgcatct
cagacagttcttggtgctgcaaccatggtaaacaagactggaaaacatccgggtcagctg
aaggatatggtcacttccccggcaggaaccaccataactgggatacaagagcttgagaag
ggtgcattccgtgggacgctgataaatgccgttgttgctgctacaaagcgttgccgtgaa
ctttctcagagttaa

DBGET integrated database retrieval system