KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326249
Entry
4326249           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, mitochondrial
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4326249
   00620 Pyruvate metabolism
    4326249
   00630 Glyoxylate and dicarboxylate metabolism
    4326249
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4326249
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4326249
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4326249
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N 3Beta_HSD
Other DBs
NCBI-GeneID: 4326249
NCBI-ProteinID: XP_015621604
UniProt: Q94JA2 A2ZW04
LinkDB
Position
1:26190759..26194479
AA seq 340 aa
MRPSLMRSASQVLRRRRGYSSASGQPERKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYD
IAGTPGVAADVSHINAPAQVKGFMGDDQLGEALEGSDIVIIPAGVPRKPGMTRDDLFNIN
AGIVKNLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRA
KTFYAGKANVPVTDVNVPVVGGHAGITILPLFSQATPATNALSDEDIKALTKRTQDGGTE
VVEAKAGKGSATLSMAYAGAVFANACLKGLNGVPDVVECSFVQSTVTELPFFASKVKLGK
NGVEEVLGLGQLSDFEKEGLENLKGELKASIEKGIKFANA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaggccgtcgctgatgagatccgcctcgcaggtcctccgccgccgccgcggctactcc
tccgcctccggccagccggagcggaaggtcgccatcctcggcgcggccggcggcatcggg
cagccgctctccctcctcatgaagctgaacccgctcgtctcctccctctccctctacgat
atcgccggcacccccggcgtcgccgccgacgtctcccacatcaacgccccggcccaggtg
aaggggttcatgggggatgaccagctcggggaggcgttggaggggtcggacatcgtgatc
atcccggccggcgtgccgaggaagcccggcatgaccagggacgacctcttcaacatcaac
gccggcatcgttaagaacctctgcaccgccattgccaagtactgcccgaatgctcttgtc
aacatgatcagcaacccagtgaattcaacggtcccaattgctgccgaggttttcaagaag
gctgggacttacgatgagaagaagttgtttggtgtgactactcttgatgttgttcgtgct
aagactttctatgctggaaaggccaatgtaccagttactgatgtgaatgtcccagttgtt
ggtggtcatgcgggtatcaccatcctgccactgttctcacaggcaactcctgcaactaat
gcgttgtctgatgaagacatcaaggctcttaccaagagaacacaggatggtgggactgaa
gttgttgaagcaaaggctggaaagggctctgcaaccttgtccatggcgtatgctggtgct
gttttcgcaaatgcttgcttaaagggtctgaatggagtgccggacgttgttgaatgctct
tttgtgcaatcaactgtaacagagctgccattctttgcctccaaggtgaagcttgggaag
aatggagttgaggaagttcttgggttgggccagctgtcagactttgagaaggaaggactg
gagaatcttaagggcgagctcaaggcttcaattgagaagggtatcaaatttgcaaatgcg
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327423
Entry
4327423           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, chloroplastic
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4327423
   00620 Pyruvate metabolism
    4327423
   00630 Glyoxylate and dicarboxylate metabolism
    4327423
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4327423
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4327423
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4327423
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C 3Beta_HSD NAD_binding_10 Epimerase Semialdhyde_dh
Other DBs
NCBI-GeneID: 4327423
NCBI-ProteinID: XP_015621579
UniProt: Q5QLS8 A0A8J8YRA3
LinkDB
Position
1:35499022..35501751
AA seq 396 aa
MASTVAINLIGAQAGIISKLRNCDITSYSGLKARSSISFESRSSFLGQNASLRSSISPRI
VPKANSGSHISPEASYKVAVLGAAGGIGQPLGLLIKMSPLVSALHLYDIANVKGVAADLS
HCNTPSQVLDFTGPSELANCLKGVDVVVIPAGVPRKPGMTRDDLFNINASIVKTLVEAVA
DNCPEAFIHIISNPVNSTVPIAAEVLKQKGVYNPKKLFGVTTLDVVRANTFIAQKKNLKL
IDVDVPVVGGHAGITILPLLSKTRPSVTFTNEETEELTRRIQNAGTEVVEAKAGAGSATL
SMAYAAARFVESSLRALAGDPDVYECTFVQSELTELLFFASRVKLGKNGVESIISSDLEG
VTEYEAKALESLKPELKASIEKGIEFVHKQQAAATS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggcatcaactgttgccatcaatttgattggtgctcaggctggcattatctcaaagtta
aggaattgcgacatcacaagctacagtggcttaaaggcaagatcatctattagttttgag
tcaaggtcatcattcctgggtcagaatgcatctcttcgatcatctatctctccaaggatt
gtaccaaaggcaaactctggatctcacatttctcctgaggcatcttacaaagtggcagtt
ctcggtgctgctggtggcattggtcaaccgttgggcttgttaattaagatgtctcctctg
gtctctgcactacatctgtatgatattgcaaatgtcaaaggagttgctgctgatctgagc
cactgcaacacaccttctcaggttctggactttactgggccctcggaattagccaactgc
ttgaaaggtgtggatgttgttgtcatccctgctggagtcccaaggaagccaggaatgact
cgtgatgatctttttaacatcaatgcgagcattgtcaagacacttgttgaggctgttgca
gacaattgtccagaagcctttatccatatcattagcaacccagtaaactcaacagtgccc
attgctgctgaggttctgaaacagaagggtgtctataaccccaagaagcttttcggagtt
accaccctagatgttgtcagagctaacacatttatagctcagaagaagaacctgaagctc
attgatgttgatgtcccagttgttggtggtcatgctgggattactatcctaccattgctg
tcaaaaaccagaccatctgtcaccttcacaaatgaggaaactgaagagctgacaaggagg
atacagaatgctgggacagaggtggtggaggcgaaagctggtgctggatctgctaccctg
tcgatggcctatgcagctgccagatttgttgagtcatccctccgtgcattggctggtgat
ccagatgtttacgagtgcacatttgttcaatctgaattaactgagctgctgttctttgca
tctagggttaagcttggtaagaatggtgttgagtccatcatttcttccgaccttgaggga
gtgactgaatatgaggccaaggcccttgagtcattgaagcctgagttgaaggccagcatt
gagaagggcatcgagttcgtccacaaacagcaggctgccgctacttcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334274
Entry
4334274           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, glyoxysomal-like
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4334274
   00620 Pyruvate metabolism
    4334274
   00630 Glyoxylate and dicarboxylate metabolism
    4334274
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4334274
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4334274
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4334274
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N 3Beta_HSD Semialdhyde_dh
Other DBs
NCBI-GeneID: 4334274
NCBI-ProteinID: XP_015630602
UniProt: Q7XZW5 Q0DN55
LinkDB
Position
3:complement(32086035..32089672)
AA seq 354 aa
MQPDSASHRIARVAAHLSPSPRPQMEEGVRPAPCRAKGGAPGFKVAVLGAAGGIGQPLSL
LMKLNPLVSVLHLYDVVNTPGVTADVSHMDTTAVVRGFLGPNQLEAALTGMDLVIIPAGL
PRKPGMTRDDLFNKNAGIVRSLCEGVAKCCPNAIVNLISNPVNSTVPIAAEVFKKAGTYD
PKRLLGVTTLDVARANTFVAEVLGIDPKDVNVPVVGGHAGVTILPLLSQVHPPCSFTPDE
ISYLTKRIQNGGTEVVEAKAGAGSATLSMAFAAAKFGDACLRAMRGDAGVVECSYVASAV
TELPFFATKVRLGRAGAEEVLPLGPLNDFERAGLEMAKKELMESIQKGIDFMNK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcagcccgactccgcctcccaccgcatcgcccgcgtcgccgcccacctcagcccgtcg
ccgcgcccccagatggaggagggggtgaggccggcgccatgcagggccaagggcggcgcg
ccggggttcaaggtggccgtgctgggcgcggcgggagggatcgggcagccgctgtcgctg
ctcatgaagttgaacccgctcgtctctgtgctccacctctatgatgtcgtcaacacgccc
ggtgtcaccgccgatgtcagccacatggacaccaccgccgtggtccgtggtttccttggg
cccaaccagcttgaggcagcacttacaggaatggatcttgtcattatccctgctggtctc
ccaaggaaaccaggaatgacaagggatgatttgttcaacaaaaacgctgggattgttcgc
tcactttgtgaaggcgttgccaagtgctgtccaaatgcaattgtgaacttgatcagcaac
ccagtgaactcaaccgtccccattgcagcagaggttttcaagaaagctggaacttatgat
cccaaacgtctccttggagttacaacactggatgtagcaagggcaaacacctttgtggct
gaagtacttggaattgacccaaaagatgtcaatgttccagttgttggtgggcatgctgga
gtgactatattacccctcctctcccaggtccaccccccatgctcatttaccccagatgaa
atcagctatttgactaaacgcatacagaatggtggcacagaagttgttgaggcaaaggca
ggagcaggctctgcaactttgtcaatggcttttgctgcagcaaaatttggtgatgcatgc
ttgcgagcaatgcgtggtgatgctggcgttgtggaatgttcatatgttgcatctgcggtg
accgagttgccgttctttgcaacaaaagtgaggttaggtcgtgctggagccgaagaggtt
ctccctctggggccgttgaatgattttgagagagctggcttggagatggcaaagaaagag
ctgatggagagcattcagaagggcatcgatttcatgaacaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336595
Entry
4336595           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, cytoplasmic-like
  KO
K00025  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4336595
   00620 Pyruvate metabolism
    4336595
   00630 Glyoxylate and dicarboxylate metabolism
    4336595
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4336595
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4336595
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4336595
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N
Other DBs
NCBI-GeneID: 4336595
NCBI-ProteinID: XP_015634484
UniProt: B9FGG9 Q7FAT9
LinkDB
Position
4:27605151..27608345
AA seq 352 aa
MMSSNSLFQRLAKWCPWLLRDEPKKPVKVLVTGAAGQIGYAIVAMIARGLMLGADQPVVL
HLLDLPVAANALNGVRMELIDAALPLLRGVVATSDEAEAFKGVNVAIVIGGWPRRDGMER
KDLISKNVTIYKSQASALHQHAAPNCKVLVVANPANTNALVLKEFAPAIPAKNITCLTRL
DHNRALGQVAEKLNVHVGDVKNAIIWGNHSSTQFPDASHATVSTDRGERPVRELIADEIW
LREEFVTDVQQRGAAVIKARKQSSSLSAASAACDHMRDWILGTPKGTWVSMGVYSDGSYG
VPEGVFFSFPVTCEKGEWSVVQGLEIDDFARSKMETSATELKEEKSIAYEFL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgatgtcatccaattccctcttccagcgtctggcaaaatggtgcccgtggttactgaga
gatgagccgaagaagcctgtcaaggttcttgtcaccggcgccgcagggcaaatagggtat
gccattgtcgcgatgatcgcgaggggcctcatgctaggagccgaccagccggtggtgctc
cacctgctggatctgccggtcgcggccaatgctctgaacggcgtcaggatggaactgatc
gacgctgcgctgccgctgctcagaggagtggtggcgacgagtgacgaggctgaggcgttc
aagggcgtcaacgtcgccatcgtcatcggtggatggccgaggagagacgggatggagagg
aaagatttgattagcaagaacgtgacaatctacaaatcccaggcctctgcgctccatcag
cacgccgccccaaactgcaaggtcttggtcgtggccaatcccgcgaacaccaacgcgctc
gtcctgaaggagttcgccccggcaatcccggccaagaacatcacctgcctcaccaggctc
gaccacaaccgcgccctcggccaggtcgccgagaagctgaacgtgcacgtcggcgacgtc
aagaacgccatcatatggggcaaccactcctccacgcagttccccgacgccagccacgcc
accgtctcgaccgaccgcggcgagaggcccgtcagggagctcatcgccgacgagatatgg
ctgagggaggagttcgtcaccgacgtgcagcagcgaggcgcggcggtgatcaaggcgcgg
aagcagtcgagctcgctgtccgccgccagcgcggcatgcgaccacatgagagactggatc
cttggaaccccaaagggtacgtgggtgtccatgggcgtttactctgacggcagctatggc
gtccccgagggcgtcttcttctcgtttccggtgacctgcgagaagggggagtggtctgtc
gtgcagggtcttgagattgacgactttgcacgctccaagatggaaacctcggcgaccgag
ctcaaggaagagaagtccattgcttatgagtttctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339682
Entry
4339682           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, mitochondrial
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4339682
   00620 Pyruvate metabolism
    4339682
   00630 Glyoxylate and dicarboxylate metabolism
    4339682
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4339682
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4339682
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4339682
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N 3Beta_HSD
Other DBs
NCBI-GeneID: 4339682
NCBI-ProteinID: XP_015639465
UniProt: Q6F361 Q65XJ3
LinkDB
Position
5:complement(28617669..28621572)
AA seq 340 aa
MRPSLLRYAAQALRRRDYSSAAAAAERKVAILGAAGGIGQPLALLMKLNPLVSSLSLYDI
AGTPGVAADVSHINSPALVKGFVGEEQLGEALEGSDVVIIPAGVPRKPGMTRDDLFNINA
GIVKGLCTAISKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAK
TFYAGKANVPVTEVNVPVVGGHAGITILPLFSQATPASNALSHEDIKALTKRTQDGGTEV
VEAKAGKGSATLSMAYAGAVFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKN
GVEEVLGLGQLSEFEKEGLENLKGELKSSIEKGIKFAHAN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaggccgtcgctgctgagatacgccgcgcaggcgctccgccgccgcgactactcctcc
gccgccgcggccgctgagcggaaggtggccatcctcggggcggcgggcgggatcggccag
ccgctcgcgctcctcatgaagctcaacccgctcgtctcgtccctctccctctacgatatc
gccggaacccccggcgtcgccgccgatgtctcccacatcaactcgccggcgctggtgaaa
ggcttcgtcggggaggagcagctcggggaggcgttggagggttcggacgtcgtaatcatc
ccggccggtgtgccgaggaagcccggcatgaccagggacgacctcttcaacatcaacgcc
ggcattgttaagggcctctgcactgccatctccaagtactgccccaacgctcttgtcaat
atgatcagcaaccctgtcaactcgactgtccccatcgcagcggaggtgttcaagaaggct
ggtacttacgatgagaagaaactgtttggtgtgaccacgcttgatgttgtgcgcgctaaa
actttctatgctggaaaggctaatgtgccagttactgaagtgaatgtccctgtggttggt
ggccatgctggtattactatcctgccactgttctcgcaggcaacccctgcaagtaatgca
ttgtcgcatgaggacattaaggctctgaccaagaggacacaagatggtgggacggaagtt
gttgaagcaaaggctggaaagggttctgcaacattgtctatggcatatgctggtgcggta
tttgcagatgcgtgcttgaaggggcttaatggagttcctgatgttgtagagtgctctttt
gtgcaatcaacagtaacagagctgccattcttcgcctcaaaggtaaggcttggcaagaac
ggagtggaggaagtacttgggctgggccagctttccgagtttgagaaggagggtctggag
aacctgaagggtgagctcaagtcttcgattgagaagggcatcaagtttgctcacgcgaac
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343993
Entry
4343993           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, chloroplastic
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4343993
   00620 Pyruvate metabolism
    4343993
   00630 Glyoxylate and dicarboxylate metabolism
    4343993
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4343993
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4343993
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4343993
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Semialdhyde_dh
Other DBs
NCBI-GeneID: 4343993
NCBI-ProteinID: XP_015645072
UniProt: Q8H4E0 A0A0P0X991
LinkDB
Position
7:complement(26153960..26156087)
AA seq 404 aa
MASAAMSTLNLSSSPLTKQQLRFGASTLSAEHVSGFSSARPAPSLCCSSSHWRAVKLRPR
RRPWRRAGNRVVAQAGGYKVAILGAAGGIGQPLSLLVKMSPLVSALHLYDIANVDGVTAD
LGHCNTPAKVAGFTGKEELAGCLAGVDVVVIPAGVPRKPGMTRDDLFGINAGIVRELVEA
VADHAPAALVHVISNPVNSTVPIAAEVLKRKGVYDPRKLFGVTTLDVVRANTFVAEMKGL
PLADVDVPVVGGHAAATILPLLSKARPKTAFTDEEVEALTRRIQNAGTEVVEAKAKAGGG
SATLSMAYAAARFLEASLRGLDGDADVYECSYVQCQAVPELPFFACRVKLGRDGVEEVAA
AGAELRGLTEFEARALEALKPQLKKSIDKGVAYAQQQPATVAMG
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggcatcagcagcaatgtctactctgaacctgagttcatctcctctgaccaagcagcag
ctccgatttggagccagcacactcagtgcagaacacgtcagtggcttcagctctgcaagg
ccagctccatcgttgtgctgctccagctctcactggcgagcggtcaagctgagaccgaga
cggcggccatggcggcgcgccgggaaccgggtcgtcgcgcaggccggcggctacaaggtc
gccatcctcggcgccgccggtgggatcgggcagccgctctcgctcctcgtcaagatgtcg
ccgctcgtctcggcgctgcacctgtacgacattgcgaacgtcgatggtgtcaccgccgat
cttggacactgcaacacgccggcgaaggtcgccgggttcaccggaaaggaggagctcgcc
ggttgtcttgccggcgtggacgtcgtcgtcatccccgccggcgtgccgaggaagccaggg
atgacgcgggatgacctgttcggcatcaacgccggcatcgtgagggagctcgtcgaggcc
gtggcggaccacgcgccggcggcgctggtgcacgtcatctccaacccggtgaactccacc
gtgccgatcgccgccgaggtgctgaagcggaagggcgtgtacgacccgcggaagctgttc
ggcgtcacgacgctggacgtcgtgcgcgccaacacgttcgtcgcggagatgaagggcctc
ccgctcgccgacgtcgacgtcccggtggtcggcggccacgcggcggccaccatcctcccg
ctgctgtccaaggcgaggcccaagacggcgttcaccgatgaggaggtggaggcgctgacg
aggcggatccagaacgccgggaccgaggtggtggaggccaaggcgaaggccggcggcggg
tccgcgacgctgtcgatggcgtacgcggcggcgaggttcctggaggcgtcgctgcgcggg
ctcgacggcgacgccgacgtgtacgagtgctcgtacgtgcagtgccaggcggtgccggag
ctgccgttcttcgcgtgccgggtgaagctgggcagggacggcgtcgaggaggtggcggcg
gcgggggcggagctccgggggctcacggagttcgaggcgcgcgcgctggaggcgctcaag
ccgcagctcaagaagagcatcgacaagggcgtcgcctacgcgcagcagcagccagcgacg
gtggcgatgggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345657
Entry
4345657           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, chloroplastic
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4345657
   00620 Pyruvate metabolism
    4345657
   00630 Glyoxylate and dicarboxylate metabolism
    4345657
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4345657
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4345657
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4345657
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C 3Beta_HSD NAD_binding_10 Semialdhyde_dh Epimerase
Other DBs
NCBI-GeneID: 4345657
NCBI-ProteinID: XP_015650665
UniProt: Q6ZA87
LinkDB
Position
8:complement(21054654..21057690)
AA seq 397 aa
MASAVTISSVGAQAGMISKPRNHGFTSYSGLKAASSVSFESGSSFLGRNASLRASVAPRI
VPKAKSGSQISPEASYKVAVLGAAGGIGQPLGLLIKMSPLVSELHLYDIANVKGVAADLS
HCNTPSQVLDFTGPSELANCLKGVDVVVIPAGVPRKPGMTRDDLFNINASIVKSLVEAVA
DNCPEAFIHIISNPVNSTVPIAAEVLKQKGVYNPKKLFGVTTLDVVRANTFVAQKKNLKL
IDVDVPVVGGHAGITILPLLSKTMPSVTFTDEETEQLTKRIQNAGTEVVEAKAGAGSATL
SMAYAAARFVESSLRALAGDPDVYECTFVQSELTELPFFASRVKLGKNGVESIISADLEG
VTEYEAKALEALKSELKASIEKGIEFVHKQQTAAASV
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcatcagctgttaccatcagttcggttggcgctcaggctggcatgatctcaaagcca
aggaatcatggcttcacaagctacagtggcctgaaggcagcatcatccgttagctttgaa
tcagggtcgtcattcctgggtaggaatgcatctctccgggcatctgttgctccaaggatt
gtaccaaaggcgaagtctggttctcaaatttctcctgaggcttcgtacaaagtggcagtg
ctcggtgctgctggtggtattggccaaccattgggccttttgattaagatgtctcctctg
gtctcagagctgcatctgtatgatattgcaaatgttaagggagttgctgctgatctcagc
cactgcaacacaccttctcaagttctggacttcactgggccctcggaactagccaactgc
ttgaaaggtgtggacgttgttgtcatccctgctggggtcccaaggaagccaggcatgact
cgcgatgacctttttaacatcaatgcgagcattgtcaagtcgcttgttgaggctgttgca
gacaattgtccagaggccttcatccatattatcagcaacccagtaaactccacggtgcca
attgctgccgaggttctgaaacaaaagggtgtgtacaatcccaagaagctctttggagtt
accaccctagatgttgttagagctaacacatttgtagctcagaagaagaacctcaagctc
atcgatgttgatgttccagttgtcggtggtcatgctgggatcacaattctaccactgctg
tcaaagaccatgccatctgtcaccttcacagatgaagaaactgaacagctgacaaagagg
atacagaatgctggaacagaggtggtggaggcgaaagctggtgctggctccgctaccctc
tccatggcctacgctgctgccagattcgtcgagtcatctctgcgtgcacttgctggcgac
cctgatgtttatgagtgcacattcgttcagtctgagttaaccgagctgccgttctttgca
tccagagttaagcttggaaagaacggtgtcgagtccatcatttctgctgaccttgaggga
gtgaccgagtacgaggccaaggcacttgaggcattgaagtctgagttgaaggccagtatc
gagaagggcatcgagttcgtccacaaacagcagacagcagcggcatctgtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348905
Entry
4348905           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, cytoplasmic
  KO
K00025  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4348905
   00620 Pyruvate metabolism
    4348905
   00630 Glyoxylate and dicarboxylate metabolism
    4348905
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4348905
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4348905
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4348905
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N 3Beta_HSD
Other DBs
NCBI-GeneID: 4348905
NCBI-ProteinID: XP_015614294
UniProt: Q7XDC8 A1YQK1 A0A8J8XV43
LinkDB
Position
10:17913821..17917768
AA seq 332 aa
MAKEPMRVLVTGAAGQIGYALVPMIARGVMLGADQPVILHMLDIPPATESLNGLKMELVD
AAFPLLKGIVATTDVVEACTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEAH
AAPNCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISEKLNVQVTDVK
NAIIWGNHSSTQYPDVNHATVKTPSGEKPVRELVADDEWLNTEFISTVQQRGAAIIKARK
QSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYGVPAGLIYSFPVTCSGGEWTIV
QGLPIDEFSRKKMDATAQELSEEKTLAYSCLN
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcgaaggaaccgatgcgcgtgctcgtcaccggcgccgcaggacaaattggatatgct
cttgtccccatgattgctaggggtgtgatgttgggtgctgaccagcctgttattctacac
atgcttgacattccaccagctactgaatctcttaatggccttaagatggagctggttgat
gctgcatttcctcttttgaagggaattgtcgcaacaactgatgttgtggaggcctgcact
ggtgtgaatgttgcggttatggttggtgggttccccaggaaggagggaatggaaaggaag
gatgttatgtcaaaaaatgtctccatctacaaatcccaagcttctgctcttgaggctcat
gcagcccctaactgcaaggttctggtagttgccaatccagcaaacaccaacgctctcatc
ttaaaagaattcgctccatccatccctgagaagaacattacttgcctcacccgtcttgac
cacaacagggcacttggccagatctctgaaaaacttaatgtccaagttactgatgtgaag
aatgcgatcatctggggcaaccactcatccacccagtaccctgatgttaaccacgccact
gtgaagactcccagtggagagaagcctgtcagggaactcgttgctgatgatgagtggtta
aatacggaattcatctctaccgtccagcagcgtggtgccgccatcatcaaggcgaggaag
caatccagtgccctatctgctgccagctctgcatgcgatcacattcgtgactgggttctt
ggcactcctgagggaacatttgtctccatgggtgtgtactctgatggttcgtatggtgtg
cctgctggtctgatctactcgttcccagtaacatgcagtggtggcgaatggacgattgtt
cagggtctcccgatcgacgagttctcaaggaagaagatggacgcgactgcccaggagctg
tcggaggagaagacgctcgcttactcatgcctcaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352871
Entry
4352871           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, glyoxysomal
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4352871
   00620 Pyruvate metabolism
    4352871
   00630 Glyoxylate and dicarboxylate metabolism
    4352871
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4352871
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4352871
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4352871
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N 3Beta_HSD Semialdhyde_dh THF_DHG_CYH_C
Other DBs
NCBI-GeneID: 4352871
NCBI-ProteinID: XP_015620524
UniProt: Q42972
LinkDB
Position
12:complement(27094697..27099377)
AA seq 356 aa
MEDAAAAARRMERLASHLRPPASQMEESPLLRGSNCRAKGAAPGFKVAILGASGGIGQPL
ALLMKMNPLVSVLHLYDVVNTPGVTADISHMNTGAVVRGFLGQPQLENALTGMDLVIIPA
GVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVNSTVPIAAEVFKKAGT
YDPKRLLGVTTLDVVRANTFVAEVLGLDPRDVNVPVIGGHAGVTILPLLSQVNPPCSFTS
EEISYLTTRIQNGGTEVVEAKAGAGSATLSMAYAASKFADACLRGLRGDAGIVECSFVAS
QVTELPFFASKVRLGRCGIEEILSLGPLNEFERAGLEKAKKELAESIQKGVAFINK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggaggacgcagcagcagcagcaaggcggatggagaggcttgcctcccacctccgcccg
cccgcttctcagatggaggaatcacccctcctgaggggctccaattgccgggcaaaaggt
gccgctccgggtttcaaggtcgccatcttgggagcgtctggtgggattggccagcctctt
gcattgctcatgaagatgaaccctcttgtttctgtgctccatctgtacgatgttgtcaac
actcccggtgtcacagctgacattagccacatgaacactggtgctgtggtgcgtggtttc
ttgggccagccacagttggaaaatgcccttactggaatggatcttgtgatcattcctgct
ggtgttcctcgtaagcctgggatgacaagggatgatttgttcaacatcaatgccggaatc
gtccggactctttgtgaaggaatcgcaaaatgctgccccaatgcaattgtgaatgtgatc
agcaaccctgtcaattctactgttccgattgctgctgaggtttttaagaaagctgggaca
tatgaccctaagcgccttttgggggtgacgacacttgatgtagtgagagccaatactttt
gtggcagaagttcttgggcttgaccccagagatgtaaatgtccctgtcattggtgggcat
gcaggagtaacaatattaccactcctttcacaggtgaatcctccctgctcattcacctca
gaagaaattagttatcttaccactcgcatacagaatggtgggacagaagtagtcgaggct
aaagctggagcggggtctgcaaccctttcaatggcgtatgcagcttctaaatttgcagat
gcttgcttgagaggattgcgtggcgacgctgggatagtggagtgctcttttgtagcttct
caggtgacagagctgcctttctttgcatccaaagtgcggttaggtcgctgtggcatcgag
gagatcttatcacttggtccattgaatgaattcgaaagagctggactggagaaggctaag
aaggagctggccgagagtatccaaaagggggtcgctttcatcaacaagtga

DBGET integrated database retrieval system