KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326891
Entry
4326891           CDS       T01015                                 
Name
(RefSeq) glutamate 5-kinase
  KO
K06981  isopentenyl phosphate kinase [EC:2.7.4.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4326891
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.26  isopentenyl phosphate kinase
     4326891
SSDB
Motif
Pfam: AA_kinase
Other DBs
NCBI-GeneID: 4326891
NCBI-ProteinID: XP_015621838
UniProt: Q5JN10 B9ET61
LinkDB
Position
1:complement(32184240..32189782)
AA seq 335 aa
MAEEAAQEQQTDPAASRPVRCIVKLGGAAITNKGELESIDAASLRSACAQLRQAMSHGGA
AGKVVGMDWSRRPGDPTGPVVDVEGLSEMGGLGLDSNFVVVHGAGSFGHFQASRSGVHKG
GLHSTLVKAGFVATRISVTSLNQEIVRALAREGIPSVGMSPFACGWSTKQRNLESVDASQ
IMLSLHVGFVPVLHGDAVLDELLDCTILSGDVIIRHLAQLLSPKYVVFLTDVHGVFDRPP
SDPNAVLLREIAVDENGSWSIVKPALKGNKKGVEISVAAHDTTGGMETKILEAAAIARLG
VDVYITKVGTEHSLRALKGDTSSEDWLGTVIRSSR
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcggaggaggcggcgcaggagcagcagacggaccccgccgcctcccgccccgtccgc
tgcatcgtcaaactcggtggagcggccatcacgaacaagggagagctggagagcatcgac
gcggcgagcttgcggtcggcgtgcgcgcagctgcggcaggccatgtcccacggcggcgcg
gcggggaaggttgtggggatggactggagcagacggcccggcgatccgaccggcccggtc
gtggatgtggagggcttgtcggagatgggaggcttggggctcgactccaacttcgtcgtc
gtccatggtgccgggtcttttggtcacttccaagcaagtagatctggagtccataaaggg
ggtcttcattcaacacttgtgaaggctggctttgtggctacaagaatttcagtcacttct
ctcaaccaggagattgttagagctcttgcaagagaaggaataccgtctgttgggatgtca
ccgtttgcttgtggatggtctactaagcaaagaaatcttgaatcagtggatgcttctcaa
atcatgctatcactccatgttggctttgtccctgttttgcatggagatgctgttcttgat
gaattgctggactgcaccattttgagtggggatgtcattatacgccatcttgcacagctt
ctgagtccaaaatatgttgtatttctgacagatgtccatggagtatttgatcgtcctcca
tcagacccgaatgcagtacttctcagagagatagcggtggatgaaaatggcagctggtcg
attgtaaaaccagcattgaaaggcaacaagaaaggagtggagatatctgtagctgcacat
gacaccactggcggaatggagaccaaaatattggaagctgctgcgatagctaggcttgga
gttgatgtgtatattacaaaggttggtacagaacattcactgagagccttaaaaggggac
acgagctcagaagattggcttggaaccgtcatacgatcttccagatag

DBGET integrated database retrieval system