KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327345
Entry
4327345           CDS       T01015                                 
Name
(RefSeq) phosphoribosylaminoimidazole carboxylase, chloroplastic isoform X1
  KO
K11808  phosphoribosylaminoimidazole carboxylase [EC:4.1.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4327345
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     4327345
SSDB
Motif
Pfam: AIRC ATP-grasp PurK_C Dala_Dala_lig_C CPSase_L_D2 2-Hacid_dh_C ATP-grasp_3
Other DBs
NCBI-GeneID: 4327345
NCBI-ProteinID: XP_015613656
UniProt: Q0JPV2 Q5QN02
LinkDB
Position
1:5406050..5412766
AA seq 631 aa
MHSRLLSAPSHASAASSSPLPFAAAHPCRASWTPRPTSPLPPLSLLRATASMHPSPPPEG
HSDQPVHGVTNTVVGVLGGGQLGKMLCQAASQMGVRMAILDPLEDCPASSVCHEHVVGSF
NDGATVSEFAKRCGVLTVEIEHVDAVTLEKLEKQGIDCEPKASTIMIIQDKYRQKTHFSK
FGIPLPDFVEVDTLSSIEKAGEMFGYPLMVKSKRLAYDGRGNAVAHDKKELSSVVASLGG
FEHGLYVERWTSFVKELSVIVARSRDGSTVCYPVVETIHKDNICHVVEAPAEVPDKIKKL
ATNVAEKAIKSLEGAGVFAVELFLTQDNQVLLNEVAPRPHNSGHHTIESCYTSQYEQHLR
AILGLPLGDPSMKAPASIMYNILGEDEGEAGFTQAHQLIERALDISGASVHWYAKPEIRK
QRKMGHITIVGPSKYSVKARLDKLLQRDAYDPKKVAVKPRAAIIMGSDSDLPVMKDAAVV
LKKFNIPFELTIVSAHRTPERMYHYALSTKERGLEVIIAGAGGAAHLPGMVASLTSVPVI
GVPIMTSSLHGTDSLLSIVQMPKGIPVATVAIGNAENAGLLAVRMLASRDPELGDKATEY
QHDLRDMVLEKAKRLEELGWEEYTELYLKKH
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgcactccaggctcctcagcgccccctcccacgcctccgccgcctcctcctcccccctc
cccttcgccgccgcccacccttgccgcgcctcctggacgccgcggcccacctccccgctg
ccgcctctatcgctgctgcgcgccaccgcctccatgcatccttctcctcctcccgagggg
catagcgaccagcctgtgcatggcgtcaccaacacggtcgtcggcgtgctggggggaggc
cagctggggaagatgctgtgccaggcggccagccagatgggggtcaggatggccatactt
gatcccctcgaggactgcccggcgagctcggtttgccacgagcatgtcgtcgggagcttc
aatgatggcgccacggttagcgagttcgcaaagaggtgcggggttttgacggtggaaatt
gagcatgtcgacgctgtaacactcgagaagcttgagaaacagggcatcgattgtgagccc
aaagcctccaccatcatgattattcaagacaagtacaggcagaaaactcatttctcaaaa
tttggaattccgttacctgactttgtggaagtagatactttaagtagcatagagaaagct
ggggaaatgtttggttatcctctaatggtcaaaagcaagagattagcatatgatggccgt
ggaaatgctgttgctcacgacaaaaaagagctatcttctgttgttgcttctcttggtggg
tttgagcatggcttgtatgttgagaggtggacatcttttgtaaaggagctttctgtcatt
gtggcaaggagcagagacggttctacggtgtgctatcctgttgttgaaaccatccacaag
gataacatctgccatgttgttgaggctcctgccgaggtgcctgataaaataaagaagttg
gctactaatgtagctgaaaaggctatcaaatcattggaaggtgctggtgttttcgctgta
gaattatttttaacacaagataatcaggttttattgaatgaagtagctccaaggcctcac
aacagtgggcatcacacaattgagtcatgttatacctcgcaatatgagcaacatttacgt
gctattcttggccttcctcttggtgatccttcaatgaaagcgcctgcatcaataatgtac
aacatcctgggtgaggatgagggtgaggcaggatttactcaagctcatcagttgattgag
agagctttggacatttcaggtgcatctgtccattggtatgcaaaaccagaaatacggaag
cagagaaagatgggccatattacaattgtggggccttcaaagtacagtgtaaaagcacgc
ttagataagttgctgcaaagagacgcatatgaccccaagaaagttgcagttaaacctcgt
gctgcaataataatgggttctgattctgatcttcctgtcatgaaagatgctgcagtagta
ttgaagaaattcaacataccttttgagcttacaattgtttcggctcatcgtacaccagag
aggatgtaccattatgcattatctactaaagaaagaggcttagaggtcataattgcaggt
gcaggtggagcggctcacttaccagggatggtggcttcattgacttctgtcccagtaata
ggagtacccatcatgacttcatctttacatggaactgattccctcctatctattgtccag
atgccgaaaggtattcctgttgctactgttgcaattggaaatgcggaaaatgcaggttta
ttggcagttaggatgctggcctcaagagatcctgagttgggggacaaggcaactgaatac
cagcatgatctgagggatatggtgttggagaaagcaaaaaggctcgaggaactaggttgg
gaggaatataccgagctatacttgaagaagcattga

DBGET integrated database retrieval system