KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327479
Entry
4327479           CDS       T01015                                 
Name
(RefSeq) cysteine synthase-like
  KO
K22846  S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent) [EC:2.5.1.144]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4327479
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.144  S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent)
     4327479
SSDB
Motif
Pfam: PALP adh_short_C2 ADH_zinc_N
Other DBs
NCBI-GeneID: 4327479
NCBI-ProteinID: XP_015621981
UniProt: Q5N761 Q0JIA3
LinkDB
Position
1:complement(34647097..34650766)
AA seq 392 aa
MAMAMASPPACPFLLSLSAGATAISTVSAAYGSVSAPRAPLFLLASPRPVPPRRPLAAGS
SSPKAAAPAAVEIPEEYVDDVDAVNIAQDVTQLIGKTPMVYLNNVVDGCVANIAAKLEYM
GPCRSVKDRIGLSMINDAEEKGLIFPNKTILVEPTTGNTGIGLASVAAARGYKLIATVPS
SIDVERCVLLRAFGAEIVLTDPNKGLKGALDKAEEIVSKTPNAYMFQQFNNSANSEIHFQ
TTGPEIWEDTLGTVDILVASIGTGGTITGTGRYLKMMNKDIKVIGVEPAETSVISGDNAG
YIPSILDVQLLDEVVKVTTTEAVDVARELALKEGLLVGISSGAATVAAINVAKRPENAGK
LIAVIFPSFGERYISSILFRPIYDSVRRMRKR
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggccatggcgatggcgtcgccgcccgcttgcccattcctcctctcgctctcggccggc
gccaccgccatttccaccgtgtccgccgcctacggttccgtttccgccccgcgcgcgcct
ctcttcctcctcgcctccccgcgtcccgtcccgcctcgccgacccctcgccgcgggctcc
tcatctcccaaggccgcggcacccgccgccgtcgagatccccgaggagtacgtggacgat
gttgatgcggtgaacattgcgcaggacgtcacccagctgattgggaaaaccccaatggtg
tatctgaataatgttgtcgacggatgtgttgctaatatcgctgcaaaacttgagtacatg
ggaccttgcaggagcgtcaaagacaggattggattaagcatgattaatgatgctgaagag
aaaggattaatttttccaaacaagaccattttggttgaaccaactactggaaatactggt
ataggcctagcttctgtggctgctgctaggggatacaagctaatagcaactgtaccttca
tcaatagatgttgagagatgtgttcttctacgtgcatttggagctgagattgtgttaact
gatcctaacaagggactaaaaggagctcttgataaagcagaggaaattgtttcgaagaca
ccaaatgcatacatgtttcagcagtttaacaattccgctaatagtgagatccactttcaa
accacaggcccagaaatatgggaagacaccttgggtactgttgacatactagttgcaagc
attggcacaggtggcaccattacaggcactgggcgttatctgaaaatgatgaacaaagat
attaaggttattggggtagaacctgctgaaactagtgtaatctctggtgataatgctggt
tatattccaagcatattagatgttcagctgcttgatgaagttgtgaaggttaccaccaca
gaggcagtcgatgttgcaagggaacttgcactaaaagagggcctgctggttggcatttcg
tcaggtgctgccacagttgctgctattaacgtcgctaaaagacctgaaaatgctggaaaa
ttgattgcggttattttccccagctttggagaaagatatatctctagcattttattccgt
ccgatatatgactcggtccgaagaatgaggaagagataa

DBGET integrated database retrieval system