KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327565
Entry
4327565           CDS       T01015                                 
Name
(RefSeq) L-2-hydroxyglutarate dehydrogenase, mitochondrial
  KO
K00109  2-hydroxyglutarate dehydrogenase [EC:1.1.99.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4327565
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.2  L-2-hydroxyglutarate dehydrogenase
     4327565
SSDB
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_2 FAD_binding_2 Pyr_redox Thi4 AlaDh_PNT_C FAD_binding_3 FAD_oxidored TrkA_N 3HCDH_N Amino_oxidase Lycopene_cycl XdhC_C HI0933_like UDPG_MGDP_dh_N Pyr_redox_3 NAD_binding_7 ThiF
Other DBs
NCBI-GeneID: 4327565
NCBI-ProteinID: XP_015648839
UniProt: Q0JID5 Q5VQP1
LinkDB
Position
1:34406251..34409191
AA seq 416 aa
MLPLRRFAGACRRRGLAGIAPGAPREAADAVVVGAGVVGLAVARALAMAGREVVVVEAAP
SFGTGTSSRNSEVIHAGIYYPPGSLKASLCVRGREMLYKYCAEREIPHKQLGKLIVATGV
AETAKLDMLLKNAKENGVDDLQMMEGSEAMEMEPELRCLKALLSPRTGIVDSHSFMLSLL
ADAENLGTAISYNTTVTNGYIGDEGLELHISESKALENHSVGSPVSPQLILFPKLLINSA
GLSAAPLAKRFHGLNQVFVPPAYYARGCYFTLSQTKSPFSHLIYPLPEDGGIGVHVTLDL
NGVVRFGPDVEWIDGGKDVTSCFLSRFDYSVNPTRCSKFYPVIRKYFPNLKDDSLEPSYS
GIRPKLSGPGQPPSDFVIQGEDIHGVPGLVNLFGIESPGLTSSLAIAEYIVSRYLR
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgctcccgctgcggcgctttgcgggggcctgccgccggcgaggcctcgccgggatcgcc
cccggagcaccccgggaggcggcggacgcggtggtggtgggcgccggcgtggtcgggctc
gcggtggcgcgcgcgctggccatggccggccgcgaggtggtggtggtcgaggccgccccc
agcttcggcaccggcaccagctcccgcaacagcgaggtcatccacgccggcatctactac
cctcccggcagcctaaaggctagtctttgtgtaagaggaagggaaatgctctacaagtac
tgtgcagaacgagaaattccccataaacagctcggtaaactcatcgttgctactggtgtt
gcagagacggcaaaattggacatgcttctcaagaatgctaaagaaaatggggtggatgat
cttcagatgatggagggttctgaagctatggagatggaacctgaacttcgctgtcttaag
gctttactgtcacctcgtactgggattgttgactctcattcattcatgctctcccttttg
gctgatgctgagaatttaggaacagccatatcttacaacacaacggttacaaatggatat
attggagatgaaggcctcgagcttcatatttctgaaagcaaagcactggagaatcattct
gtgggctctcctgtgtccccacaactcattttgtttccaaaacttctgataaattcagca
ggtttgagtgcggctccacttgctaaaagattccatggccttaaccaagtatttgtgccc
cctgcttattatgcgcgtggatgttacttcaccctttctcaaaccaagagccctttcagc
cacttgatctaccctctaccagaggatggtggcataggggtacatgtcacgctagatttg
aatggtgttgttagatttggcccagatgttgagtggatagatggtggtaaggatgtcacg
tcatgcttcctgagtaggttcgattactcagtcaatcctaccagatgttctaaattttat
cctgtaataaggaagtattttcctaacctcaaggatgattctttggaacccagttattct
gggatacgaccaaagctttctggcccggggcagcctccttcagattttgttattcagggg
gaggatatccatggtgttcctgggctggtcaacttgtttggaatagaatcccctggtctg
acgtcaagtttggctattgctgaatacattgtttcaaggtatttgagatga

DBGET integrated database retrieval system