KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327748
Entry
4327748           CDS       T01015                                 
Name
(RefSeq) alpha-glucosidase 2 isoform X1
  KO
K01228  mannosyl-oligosaccharide glucosidase [EC:3.2.1.106]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4327748
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4327748
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327748
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.106  mannosyl-oligosaccharide glucosidase
     4327748
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4327748
SSDB
Motif
Pfam: Glyco_hydro_63 Glyco_hydro_63N Trehalase RskA
Other DBs
NCBI-GeneID: 4327748
NCBI-ProteinID: XP_015620874
UniProt: A0A0P0VC79
LinkDB
Position
1:40220901..40229220
AA seq 872 aa
MSGGGGSSSVRRPVAAARSRSGPEPDARRAAAAAAAAAAAAARRRGRGDHGPLRLMEVSP
RNLLLVGTASVALLAVAFVVYTGVWQGKADGEVETPLRRAVRSVTPLDAPRMMDLPQFQG
DHKESLYWGTYRPNVYLGIRARTPLSLIAGIMWIGAKNGQYFLRHVCQDSDELSTYGWTD
HNGRDYGHQVLVDHGLLLTTSFLKEKGEGSGYGGDWAVRLNAKTDGPSLSEDQESTTHLF
FYIADEAGNSITMDSHIPSSRGHVLLASGSREEIGDWKVYLRSEENLEIHRAGFKSISMH
NLSDLVQQALATNAMQSGNLNLPDMAEDSSNVIVYQVSMKRSAEVDIVFLSGAASENPMI
EERINRLTGPVLSTRLESKQKDFEKRYDQIFNANNKINPKELSVGVAALSNLLGGIGYFY
GQSKIALPKGFTQKNGDKYIPYWPAALYTAVPSRSFFPRGFLWDEGFHQLVIWRWDVHIS
MDIIGHWLDLINADGWIPREQILGAEALSKVPEEFVLQYPSNGNPPTLFLALRDLASGIH
ANQFSDEESEKISTFLKRAYVRLNSWFQWFNSTQTGKYEGTFYWHGRDSMATRELNPKTL
TSGLDDYPRASHPNDEERHVDLRCWMLLATNCMCSIAEFLKTDSSLEKDYYKMSNQLSDF
GILNKMHLDDKTGAYFDYGNHTEKVRLRWYEVRENDVMRRELLRETLQPPQLQLVPHVGY
VSMFPFMMGAIPPESWVLEKQLDLISNSSILWTNYGLRSLSRTSSIYMKRNTEHDPPYWR
GAIWINMNYMILSGLHHYAHEDGPYKDRAKELYDELRSNLIRNIVKNYHETGFFWENYDQ
KNKGKGKGARSFTGWTSLVVLIMGESYPTLHR
NT seq 2619 nt   +upstreamnt  +downstreamnt
atgagcggcggcggcggcagcagcagtgtccggcgacccgtagccgccgccaggagccgc
tcaggtccagagccggacgcgcgccgggcggccgccgccgccgccgccgccgccgcagca
gcagcgcggcgccgtggccgcggcgaccatggccccctgcggctcatggaggtgagccca
cggaacctcctccttgtagggactgcttccgtcgccctcctcgccgtcgccttcgtggtg
tataccggcgtgtggcagggtaaggcggatggggaggtcgagacgcctctgcgcagggcc
gtgcgctccgtcacgccgcttgacgcgcccaggatgatggatctgcctcagttccaagga
gatcacaaggaaagcttgtattggggtacctacaggccgaatgtatatcttggaattcgt
gcaagaaccccgttgtctctaattgctgggataatgtggattggtgcaaagaatgggcaa
tactttcttcgtcatgtttgccaagattctgatgagcttagcacatatgggtggacagat
cacaatgggagggattatggacatcaagtgttggttgatcatggcttgttgttgaccacg
agtttcctgaaagagaaaggagagggtagcggttatggtggagattgggcagttcgattg
aatgcgaagactgatgggccaagtttaagtgaagaccaagaaagcaccacacacctgttt
ttctacatcgcggatgaagcagggaactcaatcactatggattcgcatataccttcgtca
agaggtcatgttcttttggcatctggatcccgtgaggagattggtgattggaaagtctat
ttgagatctgaggaaaatttggaaattcacagagctggattcaaatcaattagtatgcac
aatctaagtgacctagtacagcaagcccttgcgactaatgcaatgcaaagtgggaacctt
aaccttccagacatggcagaagattcttcaaatgtaatagtatatcaggtttccatgaaa
cgttctgccgaagtcgacatagtcttcttgtcaggggccgcctcagaaaacccaatgatt
gaagagcgcattaacaggctaacaggtcctgttctgagcactcgtcttgaatcaaaacag
aaggattttgaaaagagatatgaccaaattttcaatgcaaataataagattaatcccaaa
gaattatctgttggtgttgctgctttatcaaatcttcttggtggaattggctatttctat
gggcagtcaaaaattgcacttccaaaaggttttacacaaaaaaatggggataaatatatc
ccatattggccagctgcactatatacagctgtgcctagtcgctcattcttcccaagggga
tttctatgggatgagggcttccatcagttagtcatttggcgctgggatgtgcatatatcg
atggatataattggtcactggttagatctaataaatgcggatggatggattcctcgggag
caaatattaggagctgaagctttaagtaaagttcctgaggaatttgttctgcagtaccct
tccaatggaaatcccccaaccttatttcttgcactgcgtgatttggcaagtggaatacat
gcaaaccagttttcagatgaggaatctgaaaagatatccactttccttaaaagggcttat
gtaaggctgaactcttggtttcagtggttcaatagcacacaaacagggaaatacgaaggc
accttttattggcatggaagagacagcatggccaccagggagttgaatccgaagactttg
acatctggtttggatgactatccacgggcatctcatcctaatgatgaagagcgccatgtt
gacctccggtgttggatgcttttagctacgaattgtatgtgctcaattgcagagtttctt
aaaacagacagctctcttgagaaggattactacaagatgtcaaatcaactttcagatttt
gggatacttaacaagatgcacttggatgataaaaccggtgcctatttcgactatggtaac
cacacagaaaaggttcgattgagatggtatgaagttagagagaatgatgttatgagacga
gagcttttgcgtgaaacattacaaccccctcagctgcaattagtacctcatgtcggttat
gtcagcatgttccctttcatgatgggggccattccacctgaatcatgggttcttgagaag
cagcttgatcttatatcaaatagctctatcctgtggacaaattacggacttcggtcactt
tctcgaacaagttcaatatatatgaagcgcaacactgagcatgatcccccatattggaga
ggtgccatttggataaacatgaactacatgattctttcaggactacaccactatgcacat
gaggatggtccatacaaggacagggcaaaggaactgtatgatgagctaagatcaaacctg
atcaggaacatcgtgaagaattaccatgaaactgggttcttctgggaaaactatgaccag
aagaacaaaggaaagggtaagggtgcgaggtcctttactggatggacttcgcttgttgtt
cttatcatgggcgagtcctacccgaccctacataggtaa

DBGET integrated database retrieval system