KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327916
Entry
4327916           CDS       T01015                                 
Name
(RefSeq) transcription factor APG-like isoform X1
  KO
K12126  phytochrome-interacting factor 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04075  Plant hormone signal transduction
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    4327916
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4327916
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4327916
Transcription factors [BR:osa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    4327916
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 4327916
NCBI-ProteinID: XP_015619027
LinkDB
Position
1:complement(10271006..10274298)
AA seq 642 aa
MSDGNDFAELLWENGQAVVHGRKKHPQPAFPPFGFFGGTGGGGGGSSSRAQERQPGGIDA
FAKVGGGFGALGMAPAVHDFASGFGATTQDNGDDDTVPWIHYPIIDDEDAAAPAALAAAD
YGSDFFSELQAAAAAAAAAAPPTDLASLPASNHNGATNNRNAPVATTTTREPSKESHGGL
SVPTTRAEPQPQPQLAAAKLPRSSGSGGGEGVMNFSLFSRPAVLARATLESAQRTQGTDN
KASNVTASNRVESTVVQTASGPRSAPAFADQRAAAWPPQPKEMPFASTAAAPMAPAVNLH
HEMGRDRAGRTMPVHKTEARKAPEATVATSSVCSGNGAGSDELWRQQKRKCQAQAECSAS
QDDDLDDEPGVLRKSGTRSTKRSRTAEVHNLSERRRRDRINEKMRALQELIPNCNKIDKA
SMLDEAIEYLKTLQLQVQLSLTQMMSMGTGLCIPPMLLPTAMQHLQIPPMAHFPHLGMGL
GYGMGVFDMSNTGALQMPPMPGAHFPCPMIPGASPQGLGIPGTSTMPMFGVPGQTIPSSA
SSVPPFASLAGLPVRPSGVPQVSGAMANMVQDQQQGIANQQQQCLNKEAIQGANPGDSQM
QIIMQGDNENFRIPSSAQTKSSQFSDGTGKGTNARERDGAET
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgtccgacggcaacgacttcgccgagctgctgtgggagaacggccaggcggtggtgcac
gggaggaagaagcacccgcagccggccttcccgccgttcggcttcttcggtggcaccggc
ggtggcggcggcggcagcagtagtagagcccaggagaggcagcccggcggcatcgatgcg
ttcgccaaggtggggggcggcttcggcgccttgggcatggctccggcggtgcacgacttc
gcttctggcttcggcgccaccacgcaggacaacggtgatgatgacaccgttccgtggatc
cattaccccataattgacgatgaagacgccgccgcccctgctgctctcgcagcagcggac
tatggctccgacttcttctccgagctccaggcggcggcggctgccgcggcggccgccgcg
ccgccgaccgatctcgcctctctgccagcctccaatcacaacggcgccaccaataacaga
aatgctccggttgccaccaccaccaccagggaaccctccaaggaaagccacggcggcctg
tcggttcccaccacccgagccgagccgcagccgcagccacagctcgccgcagccaagctg
cctcggtcgagcggcagcggcggcggcgagggcgtgatgaacttctcgctcttctcccgc
ccggccgtcctggcgagggcgacgctggagagcgcgcagaggacgcagggcaccgacaat
aaggcgtccaatgtcaccgcgagcaaccgcgtcgagtcgacggtcgtgcagacggcgagc
gggccaaggagcgcaccggcgttcgccgatcagagggcggcggcgtggccgccgcagccg
aaggagatgccgttcgcgtccacggcagccgctcccatggccccggccgttaacctgcac
cacgagatgggccgtgacagggcaggccgaaccatgcctgtccacaaaaccgaggcgagg
aaggcacctgaggccacggtcgcgacatcgtcggtgtgctccggcaacggagctgggagt
gacgagctgtggcgccagcagaagcggaagtgccaggcccaggcagagtgctcagctagc
caagacgatgatcttgacgatgaacctggagtattgagaaaatctggaaccaggagcacg
aaacgcagccgcacagctgaggttcacaatttatcagaaaggaggagaagggacaggatc
aatgaaaagatgcgcgctctgcaagaactcattcccaactgcaacaagattgataaagcc
tcgatgctggatgaagctatagagtacctcaaaacccttcagcttcaagtacagttgtca
ttgacacagatgatgtccatgggaactgggctgtgcattcctccaatgctattaccaaca
gccatgcagcacttgcaaattccaccgatggctcatttccctcatctcggcatgggattg
gggtacgggatgggcgtcttcgacatgagcaacactggagcacttcagatgccacccatg
cctggtgctcactttccctgcccaatgatcccaggtgcgtcaccacaaggtcttgggatc
cctggcacaagcaccatgccaatgtttggggttcctgggcaaacaattccttcgtcagcg
tctagtgtaccaccatttgcatctttggctggtcttcctgttaggccaagcggggtccct
caagtatcaggcgccatggctaacatggtgcaagaccagcaacaaggcatagcgaatcaa
cagcagcaatgtctgaacaaggaagctatacagggagcaaatccaggtgattcacaaatg
cagatcatcatgcagggtgacaacgagaattttaggataccctcttcagcccaaacaaaa
agcagtcaattttcagatggtaccggcaaggggaccaacgctagagagagagatggggct
gaaacataa

DBGET integrated database retrieval system