KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329889
Entry
4329889           CDS       T01015                                 
Name
(RefSeq) glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4329889
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4329889
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4329889
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     4329889
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     4329889
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4329889
  Exosomal proteins of colorectal cancer cells
   4329889
  Exosomal proteins of bladder cancer cells
   4329889
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 4329889
NCBI-ProteinID: XP_015627059
UniProt: Q0DZS9
LinkDB
Position
2:23480220..23486693
AA seq 517 aa
MSGGSGDSSPSSGRASFSSLSGLKDLELSSESGCLSIVVLGASGDLAKKKTFPALFHLFQ
QGFLQSGEVHIFGYARSNISDDGLRERIRGYLKGASDEHISQFLQLIKYVSGSYNSGEGF
ASLNNAISENETSKNNKPGSSRRLFYLALPPSVYPSVCKMIRSYCMNPSSHSGWTRVIVE
KPFGKDLESAEELSAQLGELFNEQQLYRIDHYLGKELVQNLLVLRFANRLFLPLWNRDNI
ANVQIVFREDFGTEGRGGYFDQYGIIRDIIQNHLLQVFCLVAMEKPVSLKPEHIRDEKVK
VLQSVTPIKHDEVVLGQYDGYKDDSTVPDDSNTPTFASLVLRVNNERWEGVPFILKAGKA
LNNRKAEIRVQFKDAPGDIFKCKKQGRNEFVIRLQPSEAMYMKLTVKKPGLEMATEQSEL
DLSYGLRYQDVKIPEAYERLILDTIRGDQQHFVRRDELKAAWEIFTPLLHDIDDGKVKAL
PYKPGTRGPPEADELSKRMGYVQTHGYVWIPPTLSKF
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgtcaggaggatctggtgattcttccccttcatcagggcgggctagcttcagttctttg
tcaggtttgaaggacctagaactgtcttcagagtctggttgcttgtccattgtggtccta
ggtgcttctggagaccttgctaagaagaaaacattcccagcgctgtttcacctctttcag
cagggatttctacaatctggagaagtccatatatttgggtatgcaagatcaaatatttcg
gatgatggattaagagaacgcattcgtggatacctcaaaggagcttcagatgaacatatt
tcacaatttttgcaattaattaaatatgttagtggttcctacaatagcggggaaggattt
gcatcattaaataacgccatttcagagaatgaaacttcgaagaacaacaaaccaggaagc
tcacgtagactattttatttggcattgcctccatcagtctacccctcagtatgcaaaatg
ataagatcatactgcatgaatccatcttctcattctggctggacaagggttattgttgaa
aagccctttgggaaggacttggagtctgcagaggaactcagtgcccagcttggagagctg
tttaatgaacaacagctgtacagaattgaccactatttaggaaaagaattggtccaaaat
ctgcttgtgcttcgctttgcaaaccgtttgttcctacctctttggaatcgtgataacatt
gctaatgtacagattgtattcagagaggactttgggactgaaggacgtggagggtacttt
gatcaatatggcatcattcgtgatatcattcagaaccatttgttgcaggtcttctgtttg
gtggctatggaaaagcctgtctctcttaagcctgagcacataagagatgaaaaagtcaag
gttcttcagtcagtgacacctataaagcatgatgaggtggtccttgggcaatatgatggc
tacaaggatgactctacggtaccagatgactccaacacacctacttttgcatctcttgta
ttgagggtaaacaatgaaagatgggaaggagttcctttcattctcaaggctggcaaagca
ctgaacaataggaaagcagagatacgtgtgcagttcaaggatgctcctggtgacattttt
aaatgcaagaagcaaggaaggaatgaattcgttatacggttgcagccatcggaagccatg
tatatgaaattaactgtcaagaaacccggactagaaatggcaaccgaacaaagcgagctg
gatctgtcatatgggctacgctaccaagacgtgaagatcccagaagcgtatgaacgcctc
atcctggatacgataagaggggatcagcagcactttgttcgccgagacgaactgaaggct
gcgtgggagatcttcactccgctgctgcacgacatcgacgacggcaaggtgaaggccctg
ccgtacaagccgggaacccggggacccccagaggccgacgagctgagcaagaggatgggc
tacgtgcagacccatggctacgtttggatacctccaaccctttcaaaattctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332659
Entry
4332659           CDS       T01015                                 
Name
(RefSeq) glucose-6-phosphate 1-dehydrogenase 4, chloroplastic
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4332659
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4332659
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332659
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     4332659
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     4332659
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4332659
  Exosomal proteins of colorectal cancer cells
   4332659
  Exosomal proteins of bladder cancer cells
   4332659
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 4332659
NCBI-ProteinID: XP_015632874
UniProt: Q10M94 B9F855
LinkDB
Position
3:complement(11469756..11475842)
AA seq 629 aa
MAGLAVSASPAPAPASFRPAAAASRFGPCAQVAGPAANFRTRVCGLRCLIAAKLKFRKAL
KRHGWQLRRNLEVRANDKVPDWLEATPLTENIMSRDVQLAYDSGGETSNTCPDTLDSSVI
EQSSMHHKLNPSETHPPVLKEDPVLFDDPPESAAPLCIAVIGATGELAKNKVFPALFALY
YSGFLPQNVGIFGYSRKTLTDEDLRSMIEANLTCRVDHHENCDEKLNEFLKRTYYIDAGY
DNKDGMVKLNSKMSQIEGNCAANRIFYLAVPQEALLDVALSLADSAQTMQGWNRIIIEKP
FGFTGLSSHRVTQSLLSRFEEEQIYRIDHLLGKDLIENLTVLRFSNLVFEPLWSRTYIRN
VQVIFSEETAAEIQGRYFGNYGIIRDIVHSHILQTIALFAMEPPVSLDGEDIRDEKVKVL
RSIRQVNLEDVVLGQLKDTSVKVDRYTKSLTPTYFAAAMYIDNSRWDGVPFLIKTGIGLM
ENRAEIRIQFRHVPGNIYRERFGHDIDLDTNELILRDQPEEAILLKVNNKVPGLGLQLDA
SELNLLYRDRYNVELPDSYEHLLLDVLDGDSHLFMRSDEVAAAWNVLTPLIHEIDQNRIA
PELYEAGGRGPVNAYYLAAKHGVRLDDEW
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggcggggctcgcggtgtcggcttccccagctccggcgccggcgtccttccggccggcg
gcggcggcctcgcgcttcggcccgtgtgcacaggttgcaggacctgctgccaattttaga
acacgagtttgtggactgagatgtttgatcgctgcaaagctgaagttccggaaggccttg
aagaggcatggatggcagcttcgaaggaatctagaagtccgagccaatgataaagtgcct
gattggttggaggctacaccactgactgagaatataatgtctcgggacgtacaactcgcg
tatgattctggaggtgaaacatcaaatacatgccctgatactttggacagttcagtcatt
gagcaaagttcaatgcatcacaaacttaacccctctgaaacccatcctcctgtgctgaag
gaagaccctgttctattcgacgacccacctgaaagcgcagcgcctctttgcattgctgta
attggagcaactggtgaactggcaaaaaataaagtgttccctgcactatttgctctgtat
tacagtggttttcttcctcagaatgtcggtatatttgggtattctaggaagacactaacg
gatgaagatttaagatccatgattgaagccaatttgacctgccgggttgaccaccacgaa
aactgtgatgaaaagttaaatgaatttcttaaaaggacatactatatagatgcaggatat
gacaacaaagatgggatggtgaaactaaattccaaaatgtcacagatagagggtaattgt
gcagcaaacaggatattttaccttgctgttccccaagaggcacttcttgatgttgcactg
tcactagctgacagtgcccaaactatgcaaggctggaataggataataattgagaaacca
tttggcttcactggtttgtcttcacatcgggtaacacaatcactgctgtcaagatttgag
gaggagcagatttacaggattgatcatcttttggggaaggatctgattgaaaatctcacc
gtcttgagattttctaatttggtgtttgaacctttgtggagtcgcacctatatacgcaat
gtacaggtcatattttctgaagaaacagcagcagaaatccaagggagatactttggaaat
tatggcataattcgtgacatagtgcatagtcacattcttcaaacaatagcactatttgcg
atggaaccacctgtaagccttgatggagaggatatccgagatgaaaaggtgaaggtgctc
agatcaattcgacaggtgaaccttgaggatgttgttcttggtcaactgaaagatacctct
gtgaaagttgacagatatacaaaatcattgacaccaacctattttgctgctgccatgtac
attgacaattcgcgttgggatggagtaccatttttgatcaagacaggaattgggctcatg
gaaaatagagctgagattcgtattcagtttcgccatgttcctggcaatatctatcgtgaa
cgctttggccatgacatagatcttgacacaaatgagctgatcttgcgtgatcaacctgaa
gaagccatccttttgaaagtcaacaataaggtcccaggacttgggctccagttagatgct
tcagaactcaacctgctttacagggataggtacaatgtcgaactgccagattcgtatgag
catcttcttcttgatgtgcttgatggagacagtcatctattcatgcgcagtgatgaagta
gctgctgcatggaacgtgctaactccactaatccatgagattgatcagaatagaatagct
cctgagctctacgaggctgggggtagaggacccgttaatgcgtactaccttgctgctaaa
catggggtcagattggatgatgaatggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333103
Entry
4333103           CDS       T01015                                 
Name
(RefSeq) glucose-6-phosphate 1-dehydrogenase, chloroplastic isoform X1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4333103
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4333103
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4333103
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     4333103
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     4333103
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4333103
  Exosomal proteins of colorectal cancer cells
   4333103
  Exosomal proteins of bladder cancer cells
   4333103
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 4333103
NCBI-ProteinID: XP_015628664
UniProt: Q75IZ9 Q0DR68
LinkDB
Position
3:17067729..17072249
AA seq 577 aa
MAGTGLRFRQGAIFFSGAHAAAHPRTRTPHHHCSPQRTHDARGRCRLTAKSANGRPQISA
SFRDVAIDGAQSEDGAPEQGGSTVSITVVGASGDLAKKKIFPALFALYYEDCLPEHFTVF
GYARSKMSDEELRNMISLTLTCRIDQRENCSDKMEQFLKRCFYQSGQYNSEEGFSELDRK
LKEKEAGKVPNRLFYLSIPPNIFVDVVRSASRTASSQDGWTRFIVEKPFGRDSESSGELT
RNLKKYLAEEQIFRIDHYLGKELVENLSVLRFSNLVFEPLWSRNYIRNVQLIFSEDFGTE
GRGGYFDNYGIIRDIMQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRSMRQLRLEDVV
VGQYKGHSKGGKTYPAYVDDPTVPSGSITPTFAAAALFIDNARWDGVPFLMKAGKALHTR
RAEIRVQFRRVPGNLYGRRSRSVGGGGTTATRELEKATNELVLRVQPDEAIYLKINSKVP
GLGMRLDSSDLNLLYSERYPAEIPDAYERLLLDAIEGERRLFIRSDELDAAWAIFTPVLA
DLEANKVAPELYPYGSRGPVGAHYLAANHNVRWGDIS
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggccggcaccggcttacgattccggcagggcgccatcttcttctcaggagctcatgct
gctgctcatccaagaacaaggactcctcaccaccattgctcacctcagaggacgcacgat
gcgagaggaaggtgccgcctcacggctaagtccgcaaatggacgcccacagatcagtgcc
tccttcagagatgtggcgatagatggggcacagtctgaagatggggcgccagagcaggga
ggatccaccgtcagcatcaccgtcgtcggcgcctccggcgatctcgccaagaagaagatc
tttcccgcgcttttcgccctgtactacgaggactgcctcccggagcattttacagttttt
ggttatgctcgtagcaagatgagcgatgaagagctcaggaacatgattagcttgactctg
acatgccggattgatcagagggagaactgcagtgacaagatggaacagtttctgaagaga
tgcttttatcaatctgggcagtacaattcagaggaagggttttctgaactggacagaaag
ctaaaagaaaaggaggctggcaaggtaccaaacaggctcttttacctgtcgattccaccg
aacatatttgtcgatgtggtgagatctgctagtcgcacagcatcatctcaagacggatgg
acaaggttcatagtggagaagccattcggccgcgattccgagtcgtcaggggagctcact
cgaaacttgaagaagtacttggccgaggagcagatattcaggattgaccattatttgggg
aaggagctggttgagaacctctcggtgctccgtttctccaatctcgtcttcgagccactg
tggtcgaggaactacatcaggaatgtgcagctcatattttctgaagatttcggcacggag
ggtcgaggcggctacttcgacaactacgggatcatcagggacataatgcagaaccacctg
ctgcagatcctggccctgttcgccatggagactccggtcagcctcgacgccgaggacatc
cgcaacgagaaggtgaaagtgctgaggtcgatgaggcagctgaggctggaggacgtggtg
gtgggtcagtacaaggggcacagcaagggcgggaagacgtacccggcgtacgtggacgac
ccgacggtgccgagcggcagcatcacgccgacgttcgccgccgccgccctcttcatcgac
aacgcccgctgggacggcgtccccttcctcatgaaggccggcaaggccctgcacacgcga
cgggcggagatcagggtgcagttccggcgggtgccggggaacctgtacgggcggcggagc
cggagcgtgggcggcggcgggacgacagcgacgagggagctggagaaggcgacgaacgag
ctggtgctgcgggtgcagcccgacgaggcgatctacctcaagatcaacagcaaggtgccc
gggctggggatgaggctggacagcagcgacctcaacctgctctactccgagcgctacccc
gccgagatccccgacgcctacgagcgcctgctgctcgacgccatcgagggcgagcgccgc
ctcttcatccgcagcgacgagctcgacgccgcctgggccatcttcacccccgtcctcgcc
gacctcgaggccaacaaggtggcacccgagctctacccgtacggcagccggggacccgtc
ggagcgcactacctcgccgccaaccacaacgtccgctggggtgacattagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336209
Entry
4336209           CDS       T01015                                 
Name
(RefSeq) glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4336209
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4336209
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4336209
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     4336209
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     4336209
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4336209
  Exosomal proteins of colorectal cancer cells
   4336209
  Exosomal proteins of bladder cancer cells
   4336209
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 4336209
NCBI-ProteinID: XP_015635836
UniProt: A0A0P0WC48 Q7X7I6
LinkDB
Position
4:24261374..24267800
AA seq 505 aa
MSGGSSPRSRRSSFNSLSRDLELPSEQGCLSVIVLGASGDLAKKKTFPALFHLFAQGFIQ
SGEVHIFGYARSNLSDDGLRERIRGYLKGASEEHLSDFLQHIKYVSGSYDSGEGFEKLNK
EISEYEKSNKSESPRRLFYLALPPSVYPSVCKMIRTYCMNPSGWTRVIVEKPFGKDLDSA
EELSAQLGELFDENQLYRIDHYLGKELVQNLLVLRFANRLFLPLWNRDNIDNIQIVFRED
FGTDGRGGYFDQYGIIRDIIQNHLLQVFCLVAMEKPVSLKPEHIRDEKVKVLQSVNPIKH
DEVVLGQYEGYKDDPTVPDDSNTPTFASVVLRVHNERWEGVPFILKAGKALSSRKAEVRV
QFKDVPGDIFKCKRQGRNEFVIRLQPSEAMYMKLTVKKPGLEMATEQSELDLSYGMRYQN
VKIPEAYERLILDTIRGDQQHFVRRDELKAAWQIFTPLLHDIDEGKVKSIPYQPGSRGPK
EADELSERVGYMQTHGYIWIPPTLA
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtcaggaggatcttcaccaaggtcaagacgaagcagctttaattctttatcaagagat
ctcgaactcccttcagagcaaggttgtctctctgttattgtcctcggggcttctggagac
ctagccaagaagaaaactttcccggcactcttccatctttttgcacagggatttatacaa
tcaggtgaagtgcatatatttgggtatgcgagatcaaacctttctgatgatgggttaagg
gaacgcattcgtggatacctcaaaggagcctcagaagaacatctctcagactttttgcaa
catataaaatatgtcagtggttcctatgacagcggagaaggatttgagaaattgaacaag
gaaatttcagagtatgagaagtcaaacaaatcagaaagccctcgcaggctcttctatttg
gcattgcctccatctgtctacccttcagtctgcaaaatgatcagaacatattgcatgaat
ccatctggatggactagagtcattgttgagaagccatttggaaaggacttggactctgca
gaagaattaagtgcccaacttggggagctatttgacgaaaaccaactctacagaattgat
cactacttgggaaaagagttggtccaaaacctgcttgtgcttcgttttgccaaccgcttg
ttcttgcctctttggaaccgtgacaatattgataatatacagattgtattcagggaggac
tttgggactgacgggcgtggtggatattttgatcaatatggaatcattcgtgacatcatc
cagaaccatttgttacaggttttctgtttggttgcaatggaaaagcctgtctctcttaag
cctgagcacattagagatgagaaagtcaaggttctgcagtccgtgaaccctataaagcat
gatgaggttgtccttggacaatacgaggggtacaaggatgaccctacagtgccagatgac
tcaaacaccccaacttttgcatctgtcgtgcttcgggtacacaatgaaagatgggagggt
gttcctttcattcttaaagctggtaaagcactaagctcaaggaaagcagaagtccgtgtg
cagttcaaagatgttcctggtgacatctttaaatgtaaaaggcaaggaagaaatgagttt
gtcatacgccttcagccatcagaagccatgtacatgaaacttactgtcaaaaaacctgga
ttggagatggccaccgagcagagtgaacttgatctgtcatacgggatgcggtaccaaaac
gtcaaaattccagaggcatacgagcgtctcatattggatacgatacgaggagaccaacag
cacttcgttcgccgagatgagctgaaggctgcttggcagatcttcactcccctgctgcac
gacatcgacgaaggcaaggtgaagtctattccataccagcctggcagccgaggccccaag
gaagccgatgaactgagcgagagggttgggtatatgcagacccacggttacatatggata
ccacccacccttgcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342988
Entry
4342988           CDS       T01015                                 
Name
(RefSeq) glucose-6-phosphate 1-dehydrogenase 2, chloroplastic
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4342988
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4342988
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342988
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     4342988
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     4342988
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4342988
  Exosomal proteins of colorectal cancer cells
   4342988
  Exosomal proteins of bladder cancer cells
   4342988
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 4342988
NCBI-ProteinID: XP_015647088
UniProt: Q7EYK9 A0A0P0X512
LinkDB
Position
7:complement(12544286..12550057)
AA seq 588 aa
MALSCMRCSPAAGAVRRGLASAAPPAALSFARCGLRRAAALGWRVAAVTTTGVQGAKDAG
LEKAARSASQSKVENGSPSEIILDDFEDLSPLSENDDSTVSITVVGASGDLAKKKIFPAL
FALYYEDCLPKHFTIFGYARSKMTDAELRNMVSKTLTCRIDKRENCNEKMEEFLKRCFYH
SGQYDSEEHFMDLDKKLKQHEGSRVSNRLFYLSIPPNIFLDVVKCASKSASSGNGWTRVI
VEKPFGRDSDSSSALTRGLKQYLVEDQIFRIDHYLGKELVENLSVLRFSNLVFEPLWSRQ
YIRNVQLIFSEDFGTEGRGGYFDRYGIIRDIMQNHLLQILALFAMETPVSLEAEDIRNEK
VKVLRSMKPLQLEDVVIGQYKSHTKGGTTYPGYTEDKTVPKDSVTPTFAAAALFINNARW
DGVPFLMKAGKALHTKGAEIRVQFRHVPGNLYKRSFGTDLDTATNELVIRVQPDEAIYLK
INNKIPGLGMRLDRSNLNLHYAARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWEL
FTPLLKELEEKRIAPELYPYGSRGPVGAHYLAAKYNVRWGDLTTEQKA
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggcgctctcctgcatgaggtgctccccggccgccggcgccgtacgacgaggattggca
tcggcggctccgccggcggcgctctccttcgccagatgcggcctccgtagagcggccgcg
ctcgggtggcgcgtcgccgccgtcaccactacgggagtgcaaggtgccaaggatgctggt
ctggagaaggctgccagaagtgcttcccaatcaaaggtggaaaatggctcaccttcagaa
atcattttagatgattttgaagacttgagccctctatcagaaaatgatgactccactgtt
agtatcactgtagtcggagcatctggtgaccttgccaagaagaagatatttcctgcactt
tttgctctatactatgaagattgtcttccaaagcatttcactatcttcggatatgcacgc
agcaagatgacagatgctgaattgagaaacatggtcagcaaaacactgacatgcagaata
gataaaagggaaaactgtaatgagaagatggaagagtttttaaagagatgcttctatcat
tcaggccaatatgattcagaggagcatttcatggaccttgacaagaagctgaaacaacat
gagggttccagagtttctaaccgtcttttctacttgtcaataccaccaaatatattcctt
gatgttgtaaaatgtgcaagcaaatcagcatcatctgggaatggttggacaagggtaatt
gttgagaaaccttttggtcgtgactcagattcatcttctgcattaacaaggggtctgaag
cagtacctggtagaggaccaaatcttcaggattgaccactacttgggaaaggaactagtg
gagaacctgtctgtccttcgcttctcaaatcttgtttttgaacctctatggtcaaggcag
tatataaggaatgtgcagctgatattctcagaggatttcggcactgaaggacgaggaggg
tactttgataggtatggtattatccgtgacataatgcagaatcatcttcttcagatacta
gccctatttgcaatggaaactcctgttagcttggaggcagaggacataagaaacgaaaag
gttaaagttctgcgttccatgaagcccctgcaactggaagatgtggtgataggacagtac
aaaagtcatacaaagggtggtaccacataccctggatacactgaagataagacggtgccc
aaggatagtgtaaccccaacatttgctgcagctgcacttttcataaataatgctagatgg
gatggagttccttttcttatgaaagctgggaaggctttacatacaaagggggctgagatt
agagtacagttccgacatgttcctggtaatctttataagaggagttttgggactgatctt
gatacagccactaatgaacttgtcatacgtgtgcaacctgatgaagctatctacttgaag
attaacaacaaaattcctggtcttggtatgagactagatagaagtaatttgaatcttcac
tatgcagcaaggtactccaaggagataccagatgcttatgagaggctcttacttgatgcc
attgaaggagagcgaaggctttttatccgttctgatgagttggatgccgcatgggagctc
ttcactcccttactcaaggagctggaagagaagcggatagcccctgagctatacccttat
ggaagccgcggtcctgtaggggctcactaccttgcagcaaagtacaacgtcagatggggt
gatttgaccacagaacagaaggcatga

DBGET integrated database retrieval system