KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331095
Entry
4331095           CDS       T01015                                 
Name
(RefSeq) ABC transporter I family member 19
  KO
K12608  CCR4-NOT complex subunit CAF16
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331095
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4331095
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_28 AAA_15 AAA AAA_23 NACHT PduV-EutP AAA_25 AAA_18 AAA_5 AAA_24 AAA_33 AAA_16 AAA_30 Arf SRP54 Zeta_toxin Rad17 AAA_22 AAA_14
Other DBs
NCBI-GeneID: 4331095
NCBI-ProteinID: XP_015625286
UniProt: A3ACJ0 Q6K989
LinkDB
Position
2:34637863..34640994
AA seq 292 aa
MAGGEDEGWRRSGIEVSALQFDYDGQPPLFARFNLRIAPGSRCLLIGANGSGKTTLLKIL
AGKHMVGGRDVVRVLNGSAFHDTQLVCNGDLSYLGGSWSRAIGSAGDVPLQGDFSAEHMI
FGVDGVDPVRREKLVDLLDIDLQWRMHKVSDGQRRRVQICMGLLHPYKVLLLDEITVDLD
VVTRMDLLDFFKEECEQREATIVYATHIFDGLESWATDIAYIQEGELRKSAKYSDVEELK
SAKNLLSVVESWLRSETKLPKKEHPRPETQPRRSSPFDASPFRSSRHMAYYR
NT seq 879 nt   +upstreamnt  +downstreamnt
atggccggcggcgaggacgaagggtggaggaggagcggcatcgaggtgagcgcactgcag
ttcgactacgacgggcagccgccgctcttcgcgcggttcaatctccgcatcgcccccggc
tcacgatgcctcctcatcggcgcgaacggatcaggcaagaccactctcttgaagattctt
gcggggaaacatatggttggaggaagagatgttgtccgtgttcttaatggttctgctttt
catgacacacagcttgtgtgcaacggtgacctttcctacttaggtggttcatggagtcgg
gctatcggttcagctggtgacgttcctctgcaaggcgacttctctgctgaacacatgatt
tttggagttgatggggttgatcctgttaggcgagagaagcttgttgatctactagatatt
gatctgcaatggcgcatgcataaagtctcagatggacaacgccgcagggtacaaatctgc
atgggtcttcttcatccatacaaggtactcttgcttgatgaaatcaccgttgatcttgat
gttgtgactagaatggatctccttgacttctttaaggaagagtgtgaacagagagaagca
accattgtctatgccactcatatatttgatggattggaatcatgggctactgacattgca
tacatccaagaaggtgaattgagaaaatcagcaaaatactctgacgttgaggagctaaag
agtgccaaaaacttgctgtcagttgtcgagtcatggctgcgatctgagaccaaactccct
aagaaagaacatccccgtcctgagacccagcccaggcgctcctctccatttgatgcttca
ccgttccgatcttcacgccacatggcctactaccgttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332655
Entry
4332655           CDS       T01015                                 
Name
(RefSeq) ABC transporter I family member 20
  KO
K12608  CCR4-NOT complex subunit CAF16
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4332655
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332655
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4332655
SSDB
Motif
Pfam: ABC_tran AAA_21 Arf AAA_29 AAA AAA_23
Other DBs
NCBI-GeneID: 4332655
NCBI-ProteinID: XP_015628219
UniProt: Q10MA7 B9F850
LinkDB
Position
3:11395924..11398996
AA seq 320 aa
MAPTVEISHLSFTYPGIDGRPPPGAPPLIEDVCFSLDAGHRCLLLGSNGAGKTTILKILG
GKHMVDPSMVRVLGRSAFHDTALTSSGDLCYLGGEWRRDVAFAGYQVNIQMDISAEKMIF
GVVGVDPQRRDELIKILDIDLAWRMHKASDGQRRRVQICMGLLKPFKVLLLDEITVDLDV
LARANLLTYLKKECEERGATIIYATHIFDGLDDWPTHIVYIARGKLQLALPLEKVKEMSQ
LSLMRTVESWLRKERDEDRRRRKERKEKGLPEFDKVTEGSRVIGDPAARAVNNGWAAGRL
ASTVAGEENFIFSSNSVLRQ
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcgccaacggtggagatcagccacctctccttcacctacccgggcatcgacggccgc
ccgccgcccggcgcgccgccgctcatcgaggacgtctgcttctccctcgacgccggccac
cgctgcctcctcctcggctccaacggcgccggcaagacgacgatactgaagatactgggc
gggaagcacatggtggatccgagcatggtgcgggtcctgggcaggtcggccttccacgac
acggcgctcacatcatctggcgacctctgctacctaggcggtgagtggaggcgcgatgtt
gcctttgcgggctaccaggtaaatatacagatggacatttcagcagagaagatgatattt
ggtgttgtgggcgttgatcctcaaaggagagatgagcttatcaagattttggatattgac
cttgcctggcgcatgcacaaggcatccgatggtcaaaggagacgggtccaaatttgcatg
gggcttctcaagccattcaaagttcttcttcttgatgagatcacagtagatctggatgtg
ttggcaagagcaaatctattgacatatttaaagaaggaatgcgaggaacggggtgctaca
atcatctacgcaacacatatttttgacggacttgatgattggccaacacacattgtgtac
attgcccgtgggaagttgcaactagcactgcctttagagaaggtgaaagaaatgagccag
ttatctctcatgagaacagtggagagctggctgaggaaagagagagatgaggataggcgg
agaagaaaggaacggaaggagaagggcctcccagagtttgacaaggttactgaggggagt
cgggttataggtgatcccgctgccagagcggtgaacaatgggtgggcagcagggaggctc
gcctcaacggttgctggtgaagagaatttcattttcagctctaacagcgttcttaggcaa
taa

DBGET integrated database retrieval system