KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331540
Entry
4331540           CDS       T01015                                 
Name
(RefSeq) 24-methylenesterol C-methyltransferase 2
  KO
K08242  24-methylenesterol C-methyltransferase [EC:2.1.1.143]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4331540
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.143  24-methylenesterol C-methyltransferase
     4331540
SSDB
Motif
Pfam: Sterol_MT_C Methyltransf_11 Methyltransf_25 Methyltransf_31 CMAS Methyltransf_23 Ubie_methyltran Methyltransf_12 Methyltransf_9 MTS Methyltransf_32 TPMT PCMT Methyltransf_15 MetW Methyltransf_18 Methyltransf_2 PrmA DOT1 FtsJ
Other DBs
NCBI-GeneID: 4331540
NCBI-ProteinID: XP_015630743
UniProt: O82427 B9FAY7 Q10S41
LinkDB
Position
3:2003101..2004936
AA seq 363 aa
MEAATMAWTAAGVGMALVYWFVWVMGAAEVKGKRAVDLKMGSITNDKVKDKYTQYWSFFR
RPKETATTEASAEKVPAFVDTFYNLVTDIYEWGWGQSFHFSPSLPGRSHREATRVHEERV
ADLLQAKPGHRLLDVGCGVGGPMRAIAAHSGSNVVGITINEYQVNRARAHNRKAGLDSRC
EVVCGNFLSMPFSDASFDGAYSIEATCHAPRLQDVYGEVFRVLKPGGLYVSYEWVTTSLY
RADNPEHVEAIHGIERGDALPGLRRQDEIASIAKEVGFEVLKELDLALPPALPWWTRLKM
GRIAYWRNSLVVRVLTMLRIAPKGVCEVHEMLYETAQHLTRGGETGIFTPMHMVLLRKPV
ESK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggaggcggcgacgatggcgtggacggcggcgggggtggggatggcgctggtgtactgg
ttcgtgtgggtgatgggagcggcggaggtgaaggggaagcgggcggtggatctcaagatg
ggatccatcacgaacgacaaggtgaaggacaagtacacgcagtactggtcgttcttccgc
cgccccaaggagacggcgaccaccgaggcctccgccgagaaggtgccggccttcgtcgac
accttctacaacctcgtcaccgacatctacgagtggggttggggtcagtcgttccacttc
tccccttccctccccggccgctcccaccgcgaggccacgcgcgtccacgaggagcgcgtc
gccgacctcctccaggccaagccgggacaccgcctcctcgacgtcggctgcggcgtcggc
gggcccatgcgcgccatcgccgcccactccggctccaacgtcgtcggcatcaccatcaac
gagtaccaggtgaaccgcgcccgcgcgcacaaccgcaaggccggcctcgactcccgctgc
gaggtcgtctgcggtaacttcctctccatgccgttctccgacgcctccttcgacggcgcc
tactccatcgaggccacctgccacgcgcccaggctgcaggacgtctacggcgaggtcttc
cgcgtgctcaagccgggcggcctctacgtctcctacgagtgggtcaccacctccctctac
cgcgccgacaacccggagcacgtcgaggccatccacggcatcgagcgcggcgacgcgctc
ccgggtctccgccgccaggacgagatcgcgtccatcgccaaggaggtcggattcgaggtg
ctcaaggagctcgacctcgccctcccgcccgctctcccatggtggactcgcctcaagatg
gggcgcatcgcatactggcgcaactccctcgtcgtccgcgtgctcaccatgctccggatt
gcacccaagggcgtctgcgaggtgcacgagatgctctacgagaccgcgcagcacctcacc
cgcggcggcgagaccggcatcttcacgccgatgcacatggtgctcctccgcaagcccgtc
gagagcaaatag

DBGET integrated database retrieval system