KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331854
Entry
4331854           CDS       T01015                                 
Name
(RefSeq) phytoene dehydrogenase, chloroplastic/chromoplastic isoform X2
  KO
K02293  15-cis-phytoene desaturase [EC:1.3.5.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00906  Carotenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00097  beta-Carotene biosynthesis, GGAP => beta-carotene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    4331854
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.5  15-cis-phytoene desaturase
     4331854
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Pyr_redox FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 MCRA Lycopene_cycl UDPG_MGDP_dh_N DUF2862
Other DBs
NCBI-GeneID: 4331854
NCBI-ProteinID: XP_015633101
UniProt: Q0DUI8
LinkDB
Position
3:4409078..4414819
AA seq 578 aa
MDTGCLSSMNITGTSQARSFAGQLPTHRCFASSSIQALKSSQHVSFGVKSLVLRNKGKRF
RRRLGALQVVCQDFPRPPLENTINFLEAGQLSSFFRNSEQPTKPLQVVIAGAGLAGLSTA
KYLADAGHKPILLEARDVLGGKIAAWKDEDGDWYETGLHIFFGAYPNIQNLFGELGINDR
LQWKEHSMIFAMPNKPGEFSRFDFPETLPAPLNGIWAILRNNEMLTWPEKVKFALGLLPA
MVGGQAYVEAQDGFTVSEWMKKQGVPDRVNDEVFIAMSKALNFINPDELSMQCILIALNR
FLQEKHGSKMAFLDGNPPERLCMPIVDHVRSLGGEVRLNSRIQKIELNPDGTVKHFALTD
GTQITGDAYVFATPVDILKLLVPQEWKEISYFKKLEKLVGVPVINVHIWFDRKLKNTYDH
LLFSRSSLLSVYADMSVTCKEYYDPNRSMLELVFAPAEEWVGRSDTEIIEATMQELAKLF
PDEIAADQSKAKILKYHVVKTPRSVYKTIPDCEPCRPLQRSPIEGFYLAGDYTKQKYLAS
MEGAVLSGKLCAQSVVEDYKMLSRRSLKSLQSEVPVAS
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggatactggctgcctgtcatctatgaacataactggaaccagccaagcaagatctttt
gcgggacaacttcctactcataggtgcttcgcaagtagcagcatccaagcactgaaaagt
agtcagcatgtgagctttggagtgaaatctcttgtcttaaggaataaaggaaaaagattc
cgtcggaggctcggtgctctacaggttgtttgccaggactttccaagacctccactagaa
aacacaataaactttttggaagctggacaactatcttcatttttcagaaacagtgaacaa
cccactaaaccattacaggtcgtgattgctggagcaggattagctggtttatcaacggca
aaatatctggcagatgctggtcataaacccatattgcttgaggcaagggatgttttgggt
ggaaagatagctgcttggaaggatgaagatggagattggtatgaaactgggcttcatatc
ttttttggagcttatcccaacatacagaacttgtttggcgagcttggtattaatgatcgg
ttgcaatggaaggaacactccatgatatttgccatgccaaacaagccaggagaattcagc
cggtttgattttcctgaaacattgcctgcacccttaaatggaatatgggccatactaaga
aacaatgaaatgctaacttggccagagaaggtgaagtttgctcttggacttttgccagca
atggttggtggccaagcttatgttgaagctcaagatggttttactgtttctgagtggatg
aaaaagcagggtgttcctgatcgagtgaacgatgaggttttcattgcaatgtcaaaggca
cttaatttcataaatcctgatgagttatccatgcagtgcattctgattgctttaaaccga
tttcttcaggagaagcatggttctaagatggcattcttggatggtaatcctcctgaaagg
ttatgcatgcctattgttgaccatgttcgctctttgggtggtgaggttcggctgaattct
cgtattcagaaaatagaacttaatcctgatggaacagtgaaacactttgcacttactgat
ggaactcaaataactggagatgcttatgtttttgcaacaccagttgatatcttgaagctt
cttgtacctcaagagtggaaagaaatatcttatttcaagaagctggagaagttggtggga
gttcctgttataaatgttcatatatggtttgatagaaaactgaagaacacatatgaccac
cttcttttcagcaggagttcacttttaagtgtttatgcggacatgtcagtaacttgcaag
gaatactatgatccaaaccgttcaatgctggagttggtctttgctcctgcagaggaatgg
gttggacggagtgacactgaaatcatcgaagcaactatgcaagagctagccaagctattt
cctgatgaaattgctgctgatcagagtaaagcaaagattctgaagtatcatgttgtgaag
acaccaagatctgtttacaagactatcccggactgtgaaccttgccgacctctgcaaaga
tcaccgattgaagggttctatctagctggtgactacacaaagcagaaatatttggcttcg
atggagggtgcagttctatctgggaagctttgtgctcagtctgtagtggaggattataaa
atgctatctcgtaggagcctgaaaagtctgcagtctgaagttcctgttgcctcctag

DBGET integrated database retrieval system