KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333171
Entry
4333171           CDS       T01015                                 
Name
(RefSeq) xanthine dehydrogenase isoform X1
  KO
K00106  xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00232  Caffeine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4333171
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    4333171
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4333171
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4333171
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     4333171
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     4333171
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4333171
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 4333171
NCBI-ProteinID: XP_015630851
UniProt: Q6AUV1
LinkDB
Position
3:17985568..17998482
AA seq 1369 aa
MGSLTRAEEEETAAAEEWSGEAVVYVNGVRRVLPDGLAHLTLLQYLRDIGLPGTKLGCGE
GGCGACTVMVSCYDQTTKKTQHFAINACLAPLYSVEGMHIITVEGIGNRQRGLHPIQERL
AMAHGSQCGFCTPGFVMSMYALLRSSEQPPTEEQIEDSLAGNLCRCTGYRPIIDAFRVFS
KRDDLLYNNSSLKNADGRPICPSTGKPCSCGDQKDINGSESSLLTPTKSYSPCSYNEIDG
NAYSEKELIFPPELQLRKVTSLKLNGFNGIRWYRPLKLKQVLHLKACYPNAKLIIGNSEV
GVETKFKNAQYKVLISVTHVPELHTLKVKEDGIHIGSSVRLAQLQNFLRKVILERDSHEI
SSCEAILRQLKWFAGTQIRNVASVGGNICTASPISDLNPLWMATGATFEIIDVNNNIRTI
PAKDFFLGYRKVDLKPDEILLSVILPWTRPFEFVKEFKQAHRREDDIALVNAGMRVYIRK
VEGDWIISDVSIIYGGVAAVSHRASKTETFLTGKKWDYGLLDKTFDLLKEDVVLAENAPG
GMVEFRSSLTLSFFFKFFLHVTHEMNIKGFWKDGLHATNLSAIQSFTRPVGVGTQCYELV
RQGTAVGQPVVHTSAMLQVTGEAEYTDDTPTPPNTLHAALVLSTKAHARILSIDASLAKS
SPGFAGLFLSKDVPGANHTGPVIHDEEVFASDVVTCVGQIVGLVVADTRDNAKAAANKVN
IEYSELPAILSIEEAVKAGSFHPNSKRCLVKGNVEQCFLSGACDRIIEGKVQVGGQEHFY
MEPQSTLVWPVDSGNEIHMISSTQAPQKHQKYVANVLGLPQSRVVCKTKRIGGGFGGKET
RSAIFAAAASVAAYCLRQPVKLVLDRDIDMMTTGQRHSFLGKYKVGFTDDGKILALDLDV
YNNGGHSHDLSLPVLERAMFHSDNVYDIPNVRVNGQVCFTNFPSNTAFRGFGGPQAMLIA
ENWIQHMATELKRSPEEIKELNFQSEGSVLHYGQLLQNCTIHSVWDELKVSCNFMEARKA
VIDFNNNNRWRKRGIAMVPTKFGISFTTKFMNQAGALVQVYTDGTVLVTHGGVEMGQGLH
TKVAQVAASSFNIPLSSIFISETSTDKVPNATPTAASASSDLYGAAVLDACQQIMARMEP
VASRGNHKSFAELVLACYLERIDLSAHGFYITPDVGFDWVSGKGTPFYYFTYGAAFAEVE
IDTLTGDFHTRTVDIVMDLGCSINPAIDIGQIEGGFIQGLGWAALEELKWGDDNHKWIRP
GHLFTCGPGSYKIPSVNDIPLNFKVSLLKGVLNPKVIHSSKAVGEPPFFLGSAVLFAIKD
AISAARAEEGHFDWFPLDSPATPERIRMACVDSITKKFASVYYRPKLSV
NT seq 4110 nt   +upstreamnt  +downstreamnt
atggggtcgctcaccagggcggaggaggaggagacggcggcggccgaggagtggtcgggc
gaggcggtcgtctacgtcaacggcgtccgccgcgtgctccccgacggcctcgctcacctc
accctgctccaatacctcagagacattggtcttcctggaacaaagcttggatgtggtgaa
ggtggctgtggagcctgcactgtgatggtctcatgctatgatcaaactacaaagaagaca
cagcattttgcaatcaacgcatgcttggctccgctttattctgtggaaggaatgcacata
atcacagtagagggaattgggaatcgtcagcgaggtttgcacccaatccaggaacgttta
gccatggcccacggttcacaatgtggattttgcacccctggttttgtgatgtcgatgtat
gcattgctgagatcaagtgaacagcctcctactgaagagcagattgaagatagccttgca
ggaaatttatgtcgctgtactggctacagaccaataatagacgccttccgtgttttctcg
aaaagagatgatcttttgtacaacaattcatctctgaaaaatgcagatggccgacctatc
tgcccttcaacaggaaaaccatgttcctgcggagatcagaaagacatcaatggtagtgaa
tcttcattattgacacctacgaaaagctactcaccttgttcatacaatgagattgatgga
aatgcgtacagtgagaaagaactcattttccccccagaacttcagttgagaaaagttacg
tcacttaaattgaatgggtttaatgggattcggtggtatagacctcttaaactaaagcaa
gtattgcatttgaaagcatgctacccaaatgcaaaactaatcattggtaactctgaagta
ggagttgaaacaaagttcaagaatgcccagtataaggtcttgatctcagttactcatgtt
ccagagcttcatacccttaaagtgaaagaggatggtatacatattggttcttctgtaaga
cttgcacagctccaaaatttcctcagaaaggttattttagagcgtgattcacatgaaatt
tcatcctgtgaggcaatactgcggcaattaaaatggtttgctgggacacaaatcaggaat
gttgcttctgttggaggtaacatttgtactgctagtccaatatcagatctaaatccactt
tggatggctacaggtgcaacgtttgagataattgatgtgaacaataatattaggaccatt
cctgcaaaagatttttttctgggttatcgtaaagttgacttaaaacctgatgagatattg
ctctctgttatactgccatggacaaggccatttgaatttgtcaaagaattcaagcaggca
catagaagggaggatgacattgcgttggtgaatgctggaatgcgtgtctatataagaaaa
gttgaaggtgattggataatttcggatgtttcaattatctatggaggggtagctgcagtt
tcacaccgtgcttcaaaaactgaaacctttctcactggaaaaaaatgggactatggattg
ttggataagacttttgatctgttgaaagaagacgtagttctggctgaaaatgcacctggt
ggaatggttgaatttcgcagttcacttactttgagtttctttttcaaatttttccttcat
gttactcatgaaatgaatataaaaggattttggaaggatggattacatgcaaccaatctt
tcagccatacagtctttcactagacctgtcggtgttggaactcaatgttatgaattggtt
agacaaggaactgcagttggccaacctgtggttcacacatcagctatgcttcaggttact
ggtgaagcggaatatactgatgacacaccgacaccccccaataccttgcatgctgctctg
gtgctgagtacgaaagctcacgcacgcatattatctattgatgcttcacttgccaaatct
tcccctgggtttgcgggtctcttcctttcaaaagacgtgcctggcgctaaccatactggg
cctgttatccatgacgaggaggtttttgcatctgatgttgttacatgtgttggccagatt
gttggacttgttgtggcagatacccgtgataatgcaaaagctgctgcaaataaagtcaat
attgagtattctgaacttccagcaattttatccatagaggaagctgtgaaagctggtagc
tttcatccaaatagcaagagatgcctagtaaaaggtaatgttgaacaatgttttctgtcg
ggtgcatgcgatagaattatagaaggaaaagtacaagttggaggtcaagagcacttctac
atggagcctcagagcactcttgtatggccagttgattctggaaatgaaattcatatgatt
tcatctacccaggctccccagaagcaccaaaagtatgttgctaatgttcttggtcttcca
caatcaagagttgtttgcaagactaagcgtattggtggtggatttggtggaaaagaaacc
agatcagcaatatttgctgcagcagcatctgtagctgcttattgtttaaggcagcctgta
aagcttgttttggacagggatattgacatgatgacaactggacagaggcacagtttccta
gggaagtacaaggtgggatttaccgatgatgggaagatattggccttagaccttgatgtt
tataacaatggtggtcattcacatgatttgtcccttccagtcctggagcgtgctatgttt
cattcagacaatgtctatgatataccaaatgtcagagtcaatgggcaagtatgtttcaca
aatttcccaagcaatactgctttcagaggttttggtggtccacaagctatgctgattgca
gagaattggattcagcacatggctacagaactcaagcgaagtcctgaggagataaaagaa
cttaattttcaaagtgagggatctgtgcttcattatggccagttgcttcaaaattgtaca
atacattcagtatgggatgaactaaaggtttcttgtaattttatggaagctcgcaaagct
gtaattgattttaacaataataaccgttggagaaagcgtggcattgctatggttcccacc
aagtttgggatatccttcactacaaaattcatgaatcaggctggtgctttagtgcaagtt
tacactgatggaactgtccttgtaacgcatggtggggttgaaatggggcagggtttacac
acaaaggtagcccaagttgcggcttcatcattcaatatccctcttagctctatatttatc
tcagaaacaagcactgataaggtaccaaatgcaacaccaacagcagcctctgctagttca
gatttatatggtgctgcagttttggatgcttgtcagcaaattatggctcggatggaacct
gttgcttcaagaggaaaccacaagtcctttgctgagttggttctagcatgctacctggaa
aggatagatctctctgctcatggattttatatcactcctgatgttgggtttgactgggtg
tctggcaagggaactccattctactatttcacatacggagcagcatttgcagaagttgaa
attgataccctaactggggatttccacacaaggacagtagatattgttatggatcttggc
tgttcaattaatccggctattgatattggccagattgaaggaggttttatccaaggatta
ggttgggcggccctggaagaactaaaatggggggatgataaccacaagtggattcgacct
ggacatcttttcacttgtgggcctggctcttacaaaataccctctgtaaatgatatacct
ctaaacttcaaggtctcacttttgaagggcgttttgaatccaaaggtcattcactcatcc
aaggctgtaggagagccaccgtttttcctcggttcagccgtcttgtttgccataaaggat
gcgatatctgccgcaagagctgaggagggtcacttcgactggttcccactcgacagccca
gcaacaccggaaagaataagaatggcatgcgtggattccatcacaaagaaatttgctagc
gtatattaccgtcccaagcttagtgtatag

DBGET integrated database retrieval system