KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334679
Entry
4334679           CDS       T01015                                 
Name
(RefSeq) galactokinase
  KO
K18674  N-acetylgalactosamine kinase [EC:2.7.1.157]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4334679
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.157  N-acetylgalactosamine kinase
     4334679
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_C GHMP_kinases_N
Other DBs
NCBI-GeneID: 4334679
NCBI-ProteinID: XP_015633122
UniProt: A0A0P0W5P7 Q7Y152
LinkDB
Position
3:34974667..34980244
AA seq 506 aa
MAARVPGGGGAAAAAEAEVVPTFSSLEPIYGDGSPLDEARLRLARLADKFHAVYAARPAL
FARSPGRVNLIGEHIDYEGYSVLPMAIRQDMIVAIRRAEGKEVRVANVDDKYPICVYPAD
PDKEIDIKNHKWGHYFMCGYKGVYEYCRSKGIDMGGPVGLDVVVDGTVPTGSGLSSSAAF
VCSATIAIMGVLEKNFPKKEVAQFTCQSERHIGTQSGGMDQAISIMAKPGFAELIDFNPI
HATDVQLPPGGTFVIAHCLAESKKAETAATNYNNRVVECRLAAIVLAIKLGMETKKAVSS
VTTLSDVEGLCVSFAGKEGSSDPGVAVKKLLHEESYTTEEIEKITGQSLTSIFQSSQTSL
DVLRAAKHFKLFQRAFHVYSEARRVYAFRDTVLSKLSAEDMLQKLGDLMNESHYSCSVLY
ECSCPELEELVKVCRDNGALGARLTGAGWGGCAVALVKEGIVPQFILNLKETYYKSRIDR
GVINQKDLGLYVFASKPSSGAAIFKL
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggcggctcgggtgcccggaggaggaggcgccgccgcggcggcggaggcggaggttgtc
ccgacgttctcctccctggagccgatctacggcgacggctctccgctcgacgaggcgcgc
ctccgcttggcccgcctcgccgacaagttccacgccgtctacgccgcgcgccccgcgctc
ttcgcccgctctccggggcgggtgaatctgataggggagcacatcgactacgaggggtac
tcggtgttgcccatggccatccggcaggacatgatcgtcgccatcaggagggcagagggg
aaggaggtgcgcgtcgccaatgtcgacgacaagtaccccatctgtgtctacccggccgac
cccgacaaggaaattgacataaaaaaccacaaatggggccactatttcatgtgtggatac
aagggagtttatgagtattgtaggtcaaaagggatagatatgggtggacctgttggcctt
gatgtagttgttgatggcacagttcctacaggatctggactttcaagctcagcagcattt
gtctgttcagcaacaattgctatcatgggagttcttgagaaaaatttcccaaagaaagaa
gttgcacaattcacctgtcaatctgagcgccacattggaacacaatctgggggcatggat
caggctatatctatcatggccaaacctggatttgctgagttgatagatttcaatccaatc
catgccactgatgtgcaactacctccaggcggtacatttgtgattgcccattgcctggca
gagtccaagaaagcagagacagctgcaacaaactataacaaccgtgttgttgaatgtcgc
ctggctgcaattgttcttgccatcaaactagggatggaaacaaaaaaggctgtctcctct
gttaccaccctctctgatgttgaggggttatgtgtctcttttgctggaaaagagggttct
tctgatcctggagttgccgtgaagaaactattacatgaagaatcatatacaacagaagaa
atagagaaaattacaggtcaaagcctgacatctatcttccagagctctcaaacttccttg
gatgttctaagagcagcaaagcatttcaagttatttcagcgtgcctttcatgtgtactcg
gaagcaaggcgggtttatgccttcagagatactgtattgtcaaaactcagtgcggaagat
atgcttcaaaaactgggcgatcttatgaatgaaagtcactatagctgcagtgtgttatat
gaatgcagctgtcccgagttggaagagcttgtaaaagtatgtagagacaacggagcactc
ggagcacgtcttactggagcagggtggggtggctgtgcagtcgctttggttaaggaaggc
attgtcccgcagtttattctcaatttaaaggaaacgtactataaatcaaggatcgaccgg
ggagtgatcaaccagaaggatcttgggttgtacgtgttcgcgtccaagccgtcgagtgga
gcagccatattcaagctgtag

DBGET integrated database retrieval system