KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335425
Entry
4335425           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4335425
  KO
K18463  WASH complex subunit CCDC53
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4335425
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4335425
Membrane trafficking [BR:osa04131]
 Protein recycling
  Others
   WASH complex
    4335425
SSDB
Motif
Pfam: CCDC53 Laminin_II NBP1 rpo132
Other DBs
NCBI-GeneID: 4335425
NCBI-ProteinID: XP_015634229
UniProt: Q0JEA9 A0A0P0W8D0
LinkDB
Position
4:complement(13618670..13625115)
AA seq 141 aa
MLRHLKSAAARSPMRSPPPHPPSAPAPRDEGFEEEEEEEESARAIAVSDQRTIYLVNMFI
ANTVEFLNSFAAQCNDKLSLLHRKIVKLDSSLNLLEAKLRSIDDTNAFGHSTNQKAHGLF
TQDGRFEPTNLLGESSRSGDA
NT seq 426 nt   +upstreamnt  +downstreamnt
atgctgcgccacctgaagtcggccgcggcgaggagccccatgcgctcgccgccgccgcat
cctccctccgcaccggcgccgagggacgaggggttcgaggaggaggaggaggaggaggag
agcgcgagggccatcgccgtctccgaccagaggaccatctacctggtgaacatgttcata
gcgaacacggtggagttcctcaactcgttcgcggcgcaatgcaatgacaagctttccctc
ctccacaggaaaatagtgaaactagactcatctctcaaccttctggaagcaaaactacgc
agtattgatgacactaatgcatttggacattcaacaaaccaaaaggcacatggattattc
acacaagatggaagatttgaacctacaaatttattgggtgaatcctctaggtctggtgat
gcttga

DBGET integrated database retrieval system