KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335673
Entry
4335673           CDS       T01015                                 
Name
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4335673
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     4335673
SSDB
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Other DBs
NCBI-GeneID: 4335673
NCBI-ProteinID: XP_015635806
UniProt: A0A0P0W9W2
LinkDB
Position
4:19175708..19182548
AA seq 1016 aa
MGWFRAASGLARVALRRNLARAPANPFAGPAPRYFHSTRPRRFAAPVPRAVPLSRLTDSF
LDGTSSVYLEELQRAWEADPTSVDESWDNFFRNFVGQAATSPGISGQTIQESMRLLLLVR
AYQVSGHLKAKLDPLALEERPIPDVLDPAFYGFSEADLDREFFLGVWRMAGFLSENRPVQ
TLRSVLERLEQAYCGTIGYEYMHIPDREKCNWLRDRIETVNAREYSYDRRQVMLDRLMWS
TQFESFLAQKWTTAKRFGLEGAETLIPGMKEMFDRAADLGVESIVIGMPHRGRLNVLGNV
VRKPLRQIFSEFSGGTKPAEEGEGLYTGTGDVKYHLGTSYDRPTRGGKHIHLSLVANPSH
LEAVDPVVAGKTRAKQYYSNDLDRTKNLGVLLHGDGSFSGQGVVYETLHLSALPNYTTGG
TIHIVVNNQVAFTTDPRAGRSSQYCTDVAKALDAPIFHVNGDDLEAVVHVCELAAEWRQT
FHSDVVVDIVCYRRFGHNEIDEPSFTQPKMYKIIRNHQSALEIYQNRLLESGKISKEDID
KMQKKVSTILNDEFQNSKEYIPNKRDWLSAYWTGFKSPEQISRIRNTGVKPEILKRVGEA
MTTLPENFKPHRAVKKIFELRRQMIETGEGIDWAVGEALAFATLIIEGNHVRLSGQDVER
GTFSHRHAVIHDQETGEQYCPLDNLVMNQDEELFTVSNSSLSEFAVLGFELGYSMENPNS
LVLWEAQFGDFSNGAQVIFDQFLSSGEAKWLRQTGLVVCLPHGYDGQGPEHSSARLERFL
QMSDDNPYVIPEMDPTLRKQIQQCNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKN
LLRHKDCKSNLSEFDDLAGHPGFDKQGTRFKRLIKDQNNHKDLEEGIKRLVLCSGKVYYE
LDEERRKKERDDVAICRVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYINPR
LLTAMRALGRGTIDDIKYVGRAPSAATATGFYSVHVQEQTELVQKALQRDPINSPF
NT seq 3051 nt   +upstreamnt  +downstreamnt
atggggtggtttcgggctgcgtccggattggctcgggtggcgctgaggaggaacctggcg
cgtgctccggcgaacccttttgccggtcctgcgccacggtacttccactccacccgcccc
cggcggttcgccgctcctgtgccccgcgccgtgccgctctcgcgcctcaccgacagcttc
cttgatggcaccagcagcgtgtaccttgaggagctccagagggcgtgggaggctgatccc
acctctgtcgacgagtcctgggacaatttctttcggaactttgtcgggcaggctgcaact
tcgcctggcatatctgggcagacaattcaggaaagcatgaggttgctgcttcttgtgcga
gcgtaccaggtgagtggtcacctgaaggctaagcttgatcctctcgcgctagaggagcgg
cctatccctgatgttctggaccctgcgttctatgggttctctgaggctgatctggaccgg
gagttttttcttggtgtgtggaggatggctgggttcttgtcggagaatcgccctgtgcag
acactccgttctgtgttggagcggcttgagcaagcttactgtggtaccattgggtatgag
tacatgcacatacctgacagggagaaatgtaattggctgagggataggattgagacggtc
aatgcaagggagtactcctacgaccgtcgccaggtcatgcttgataggctcatgtggagc
actcagtttgagagcttcttggcacagaaatggacgaccgccaagcggtttggtcttgaa
ggtgcggagacactgatccctggcatgaaggagatgtttgacagggcagctgatcttggt
gtagagagcattgtgattggtatgccacacagaggtaggctgaatgtcttgggaaatgtc
gtgaggaagcccttgcgacagatcttcagtgagtttagtggtggtaccaagcctgccgaa
gaaggggagggcttgtatacagggactggagatgtcaaataccatctaggaacttcatac
gataggcctaccagaggtggaaagcatatccatctgtctctggttgcaaacccaagtcat
ttggaagcagtcgatcctgttgttgctgggaagaccagagcaaaacagtactattctaat
gatcttgacaggaccaagaatttaggagtcttgttgcatggtgatggaagcttctcaggg
cagggtgtagtgtatgaaaccctgcatctcagtgctcttccaaactacactactggtggg
acaattcacattgtggtcaataatcaggttgctttcactactgatccaagggcagggagg
tcttcgcagtattgcacagatgttgctaaagcattggatgctccaattttccatgtgaat
ggtgatgacttggaggcagtggttcatgtctgtgagcttgctgcggagtggcggcaaaca
tttcattctgatgttgtggtggatattgtatgctaccgccggtttgggcataacgagatt
gatgagccttccttcacccagcctaaaatgtacaagataattaggaaccaccagagtgct
cttgagatataccaaaacagacttttagaatctgggaagatatccaaggaagatattgat
aagatgcagaagaaggtcagcactatcttgaatgatgaattccaaaacagcaaagaatat
attcccaataagagagactggctctcagcttactggactggattcaagtcaccagaacag
atttcacgaatccgaaatactggtgtcaagccagagattctaaaacgtgttggagaagcc
atgactactctgcctgaaaatttcaagccccacagggctgtcaaaaagatttttgagctg
cgtcgtcagatgattgagacgggcgaaggcattgattgggctgttggtgaagcacttgct
tttgcaactcttataattgagggaaaccatgttaggttaagtggtcaggatgttgagagg
ggtacattcagccaccgccatgctgttatccatgaccaggaaactggagagcaatactgt
ccgcttgataatcttgttatgaatcaagatgaggaactatttactgtaagcaacagttcc
ctgtcagagtttgctgttttgggctttgaattgggctattccatggagaatccaaactca
ctggttttatgggaagcccagtttggtgatttttccaatggagctcaagtgatatttgat
cagtttctgagtagtggagaggcaaaatggctccgccagaccggtcttgtcgtttgcctt
cctcacggatatgatggtcaggggcctgaacattccagtgcaaggttggagcgtttcctt
cagatgagtgatgacaacccttatgttattcctgagatggatccaactctgaggaagcaa
atccagcagtgcaactggcaagttgtgaatgtcacaactcctgcaaactatttccatgtc
ctgcgtcgccagattcaccgggacttcagaaagcctttgattgttatgtctccaaagaat
ctccttcgacacaaggactgcaaatcgaatctttctgaatttgatgaccttgctggtcac
cctggatttgacaagcaaggaacccggtttaagcgtctaattaaagatcagaacaaccat
aaggaccttgaggagggaatcaagcgtttagttctctgttctggaaaggtatattatgag
ttggacgaagaaagaagaaaaaaggagcgtgatgatgttgctatatgtagagttgaacag
ctctgtccattcccatatgacctcatccagcgcgagttgaagcgatatccaaatgccgag
attgtttggtgccaagaggaacccatgaacatgggggcgtacagctacatcaatcctcgc
ctcctgaccgcgatgagggcgcttggtcggggcacgatagacgacatcaaatacgttgga
agggccccatctgcagccaccgcaacaggtttctactccgtccatgtgcaggagcaaacc
gagcttgtgcagaaggcactgcagcgagaccctatcaactctccattttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344403
Entry
4344403           CDS       T01015                                 
Name
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4344403
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     4344403
SSDB
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N Mrx7
Other DBs
NCBI-GeneID: 4344403
NCBI-ProteinID: XP_015646480
UniProt: Q0D3B2 Q6Z3X5
LinkDB
Position
7:29656867..29662472
AA seq 1008 aa
MAWLRAASGLARHALRRRVPVASRFFHSARPAWRSSAPVPRAVPLSRLTDSFLDGTSSVY
LEELQRAWEADPSSVDESWDNFFRNFLGQAAPSSAGLSGQTIQESMQLLLLVRAYQVNGH
MKAKLDPLRLDDRAVPDDLDLSLYGFTEADLDREFFLGVWRMAGFLSDNRPVLTLREILS
KLEQAYCGPIGYEYMHIPDRDKCNWLRDKIETAKLKEYNKDRRLVMLDRLIWSTQFENFL
ATKWATAKRFGLEGGETLIPGMKEMFDRAADLGVENIVIGMPHRGRLNVLGNVVRKPLSQ
IFSEFTGGTRPVEGEDGLYTGTGDVKYHLGTSYDRPTRGGKRIHLSLVANPSHLEAVDPV
VIGKTRAKQFYSNDLDRTKNMGILIHGDGSFAGQGVVYETLHLSALPSYTTGGTIHIVVN
NQVAFTTDPRAGRSSQYCTDVAKALNAPIFHVNGDDLEAVVRVCELAAEWRQTFHSDVVV
DLICYRRFGHNEIDEPSFTQPKMYQVIKNHPSSLKLYEQKLLGTGEVSKEDVQKIHEKVN
RILNEEFAKSKDYVPNKRDWLSAYWTGFKSPEQISRVRNTGVNPGVLKRVGQAITTLPED
FKPHRAVKKIFEQRAAMIESGEGIDWAVAEALAFATLIVEGNHVRLSGQDVERGTFSHRH
AVLHDQENGRKHCPLDHVVMNQNEELFTVSNSSLSEFAVLGFEMGYSMENPNSLVLWEAQ
FGDFSNGAQVMFDQFLSSGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNP
FVIPEMEPTLRKQIQECNWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNLLRHKDC
KSNLSEFDDVEGHPGFDKQGTRFKRLIKDRNDHKQVEEGIKRLVLCSGKVYYELDEERKK
TERSDVAICRVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGAYSYISPRLYASMKT
LGRGSFDDIKYVGRAPSAATATGFLSVHAQEQTELVKKALQAEPIKFP
NT seq 3027 nt   +upstreamnt  +downstreamnt
atggcgtggctccgcgccgcctcgggcctcgcccgccacgccctccgccgccgcgtgccc
gtcgcttcccgtttcttccactcggcgcggccggcctggaggtcctccgccccggtgccc
cgcgccgtcccgctgtccaggcttaccgacagcttcctcgacggcaccagcagcgtctac
ctcgaggagctccagcgcgcatgggaggccgacccctcctccgtcgacgaatcctgggac
aacttcttccgcaacttcctcggccaggccgcgccctcctccgccggcctctccggccag
accatccaggagagcatgcagctcctcctcctcgtccgtgcctaccaggttaacggccac
atgaaggccaagctcgacccgctccgactcgacgaccgcgccgtcccggacgacctcgac
ctttccctctacggcttcaccgaagctgacctcgaccgcgagttcttcctcggcgtttgg
aggatggccggtttcctctccgacaaccgccccgtcctcaccctccgcgagatcctcagc
aagctcgagcaggcctactgcggccccatcggctacgagtacatgcacatccctgacagg
gacaagtgcaactggctaagggacaagatcgagaccgccaagctcaaggagtacaacaag
gaccgccgcctcgtcatgctggacaggctcatctggagcacccagtttgagaacttcctc
gccaccaagtgggccactgccaagcgctttggcctcgagggcggcgagaccctcatccct
ggcatgaaagagatgtttgacagggctgccgaccttggcgtcgagaacattgtaatcggc
atgccacacaggggaaggcttaatgtgcttggcaatgttgtccgcaagcccttgtcgcag
attttcagtgagttcaccggtgggactaggcccgtcgaaggcgaggatggcctctacact
ggaaccggtgatgtcaagtaccatctgggcacctcctatgacaggccaactcgaggtgga
aagaggatccacctatcgttggttgcgaatcccagtcacctcgaggctgtcgatcctgtt
gtcataggcaagacgcgggcaaagcaattttactccaatgatcttgacaggacaaagaac
atgggcattctcatccatggagatggcagctttgctgggcagggtgttgtctatgagaca
cttcatctgagtgcccttccaagctatacaactggaggaaccatccacatcgttgtcaat
aaccaagttgccttcacaacagatccaagagccggcagatcttcgcagtattgtacggat
gttgccaaagccttgaacgctcctatattccatgtaaacggtgatgatctggaggcagtt
gtacgagtttgtgagcttgcagctgagtggcgccagactttccattctgatgtggtagtc
gatctgatctgttaccgacgatttggacataatgaaatcgatgagccctccttcacacag
ccaaagatgtatcaggttattaagaaccatcctagttcattaaagctttatgaacagaaa
ctgctaggaacaggcgaagtctcaaaagaagacgttcagaagatccacgagaaagtcaac
agaatcctgaatgaagagtttgcaaaaagcaaagattatgttcccaataagagggactgg
ctttcggcttactggactggcttcaagtctcctgagcagatttcacgcgtccgcaacact
ggggttaatccaggggtgctgaaacgtgttggacaggcaattactactttacctgaagac
ttcaagccccacagggcagtgaagaagatttttgagcagcgtgcagcaatgatcgagagc
ggtgaaggaattgattgggccgttgctgaagcccttgcctttgcaacactcattgtggaa
ggcaaccatgttaggctgagtggacaggacgtggaaagaggaacttttagccaccgtcat
gcagttctgcatgaccaggaaaacgggaggaaacattgcccacttgaccatgttgtgatg
aatcaaaacgaggagctgtttaccgttagcaacagttcactttcagaatttgctgttctt
ggttttgaaatggggtactccatggagaaccctaattcactagtgctctgggaagctcag
tttggtgacttttccaatggtgcacaagtgatgtttgaccagtttttgagtagtggagag
gcaaaatggctgcgtcaaactggccttgtcgttctactgcctcatggttatgatggccaa
ggcccagagcattccagtgcccgtttggagcgctttcttcagatgagtgatgataatcct
tttgtcatacctgagatggaaccaacactccgcaagcagatccaggagtgtaattggcaa
gttgtgaacgtgacaacgcctgcaaactatttccatgtgctgcgtcgtcagatacatagg
gagttccggaagcccctgattgtaatggcccccaagaacctacttcggcacaaggattgc
aagtcaaatctctctgagtttgatgatgttgaaggccatccaggtttcgataagcaagga
acacgcttcaagcggttgataaaggaccggaatgaccacaagcaagtcgaggagggtatc
aaacgccttgtattgtgttctgggaaggtgtactatgagcttgatgaagaacggaagaag
actgaacgcagtgatgttgcaatttgcagagttgaacaactttgtccattcccatatgat
cttatccagagagagctaaaaagatatccaaatgcggagattgtctggtgccaagaggaa
cccatgaatatgggcgcatatagttacatctcccctcgcctgtacgcctctatgaagact
cttgggcgtggttcattcgatgacatcaagtatgtgggcagggcgccttcagctgcgaca
gctactggcttcctgtcggttcatgcgcaggagcagacagagctggtaaagaaagcactg
caggcagagcctatcaagttcccctga

DBGET integrated database retrieval system