KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336325
Entry
4336325           CDS       T01015                                 
Name
(RefSeq) putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
  KO
K03850  alpha-1,2-glucosyltransferase [EC:2.4.1.256]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4336325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4336325
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.256  dolichyl-P-Glc:Glc2Man9GlcNAc2-PP-dolichol alpha-1,2-glucosyltransferase
     4336325
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4336325
SSDB
Motif
Pfam: DIE2_ALG10
Other DBs
NCBI-GeneID: 4336325
NCBI-ProteinID: XP_015636083
UniProt: Q7F8Z1
LinkDB
Position
4:complement(25144617..25149602)
AA seq 506 aa
MGRLTVAAAVAAWAIPLAALVASIVPDPYMDEIFHVPQVQRYCRGDFLIWDPMITTPPGL
YYISLAYVASLFPGAWVTRIAEAFDALCTTALLRSTNVIMAMICGVLVHDLLLCIRPKIG
KRKATAFAILVALYPIHWFFTFLYYTDVASLAAVLAMYLFCLKKQFWVSAAFGAFSILLR
QTNVIWMIFFAANGAIAHAQYLYVKDNVCYENSELTDKSNKEASHMDNKTTAPGLRRRRN
NNPINKREVVSESNIMYSSFTEEIWDAIFKLWNSKCEVLIAFIPFAMVLLVFVAFIVWNG
GIVLGAKEAHVVSPHFAQFLYFGLVSAAALLPWHFTPTRASDLFHWCRKNKTYSSFAILV
ALGLSLVAVHLFSIAHPYLLADNRHYTFYIWRKVIQVHWMMKYILTPVYVYSWFSIVNIL
GKSQTRLWVLSFVLSVALALIPAPLVEFRYYTIPLVILVLHSPVISNVKLLALGFLYAAV
DFFTLAMFLFRPFQWQHEPGTQRFIW
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggggaggctgaccgtcgccgcggcagtggccgcatgggcgatcccgctcgctgctctg
gtcgcctccatcgtgcccgacccttacatggatgagatcttccatgttccccaggtgcag
cgctattgccgtggagatttcttaatatgggatcccatgatcaccacccctcctggcctg
tactacatttcactagcatatgttgcttccttgtttcctggtgcatgggtgactagaata
gcagaggcatttgatgccctttgcactacagcacttctgagatccactaatgttatcatg
gcgatgatctgtggtgttctagtccatgacctgcttttgtgcatcaggccaaaaattggc
aagaggaaggcaactgcatttgctattttagtagctttgtaccctattcattggttcttt
actttcctttattatactgatgttgcatcattagcggcagttcttgcgatgtaccttttc
tgcttgaagaaacaattttgggtcagtgcagcgtttggtgctttttctatacttctccgg
cagactaatgtaatatggatgatattttttgctgccaatggagccatcgctcatgcacaa
tatctttatgtcaaggacaatgtttgttacgagaacagtgaactaacagataagtcaaac
aaagaggcatctcacatggataataaaaccactgctccaggtttgagaaggcggcgaaac
aataatcccataaacaagagagaagttgtttctgaatcaaacattatgtattccagtttt
acagaggaaatatgggatgccatcttcaagttatggaattcaaagtgtgaagttttaatt
gcttttataccatttgcaatggttcttttggtgtttgtggcattcatagtctggaatggt
ggcatagtgctaggtgctaaggaagctcatgttgtttcaccacactttgcacagtttttg
tactttggtctagtgtcagctgctgccctcctgccatggcattttactcctacccgagca
tcagacctattccactggtgcagaaagaacaaaacatatagttcttttgcaattttggtg
gctcttggtttaagccttgttgctgtacatttattcagcattgctcatccatatcttctt
gctgacaatagacactacaccttttatatttggaggaaggttatccaagttcactggatg
atgaaatacattttgactccagtttatgtgtactcatggttttcaattgttaatatctta
gggaagtcacagacaagactttgggtgctgtcctttgttctatcagttgcccttgctctc
atccctgccccattggttgaatttagatactatacaattccattggtcatactggttctt
cattctccagtgatcagcaatgttaaattgcttgctttggggtttctttatgccgctgtt
gacttcttcactctggcaatgtttctgttcagacctttccagtggcaacatgagcctggg
acacaaaggtttatttggtag

DBGET integrated database retrieval system