KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336475
Entry
4336475           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein At4g19900
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    4336475
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4336475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4336475
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     4336475
Glycosyltransferases [BR:osa01003]
 Glycan extension
  P blood group
   4336475
SSDB
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth
Other DBs
NCBI-GeneID: 4336475
NCBI-ProteinID: XP_015636744
UniProt: Q0JBJ1 A0A8J8Y218
LinkDB
Position
4:26504093..26506557
AA seq 464 aa
MAPVATKANAMAPAPPPPTMAPPPTPRKPLPLLLLSLSLPFLLLLLSLVFLLSHTTFSLL
LCPLLPRPTSRPNATTMATTTVAAAPPTLDVSMDKSLRAFHASSPPPPTPTTTTTPTPTP
PLPPPAPPASPAKSNKKASAKRNKSLLKLLLRETPRTRRFAARAGELFASPRPCTRRFFM
TWLSPLARFGRRELLVVESLFRSHRDACLLIASDTMDSDGGGDRLGPFLDRGLRVAAASP
DMAYLLNGTPAEAWLGAVQRGDVSPGSIPLGQNLSNLLRLALLYKYGGVYLDADVVVLRP
FSDLRNAIGAQAVDASTGDWMRLNNAVMVFDRGHPLLREFIAEFAAKFDGSKWGHNGPYL
VSRVAARWRRRRRPEAEADLTVLPPAAFYPVDWNKIGGLFVAPKDRKGERWVKAKVESIK
GESFGIHLWNRESRSLEMEEGSVIGRLLSDSCLFCNSSMFAKYE
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcgccagttgccaccaaggcgaacgccatggcgcctgctcctcctcctccgacgatg
gcgccgccgccgacgccgcggaagccattgccattgctcctcctctccctctccctccct
ttcctcctcctgcttctctccctcgtcttcctcctctcgcacaccaccttcagcctcctg
ctctgcccactcctcccgcggccaacttcgaggccgaatgccacgacgatggctacgacg
acggtggccgctgctcctcctacacttgatgtatccatggacaagtcgctgcgagccttc
catgcatcgtcgccgccgccgccgacaccgacgacgacgacgacaccgacaccgacacct
cctcttccgccgccggctcctcctgcttctcctgccaagagcaacaagaaggcgtccgcg
aagaggaacaagagcctcctcaagctgctgctcagggagactccccggacgcggcggttc
gcggcgcgcgcgggcgagctcttcgcctcgccgcggccgtgcacgcggcgctttttcatg
acgtggctctccccgctcgcgcggttcggccgccgcgagctcctcgtcgtggagagcctc
ttcaggtcgcaccgcgacgcctgcctcctcatcgcctccgacaccatggactccgacggc
ggcggcgacaggctcggcccgttcctcgaccgcggcctccgcgtcgccgccgcctcgccg
gacatggcctacctcctgaacggcacgccggcggaggcgtggctgggcgcggtgcagcgc
ggggacgtcagccccggcagcatcccgctcgggcagaacctctccaacctcctccgcctc
gccctgctctacaagtacggcggtgtctacctcgacgccgacgtcgtcgttctcaggccc
ttctccgacctccgcaacgccatcggcgcgcaggccgtggacgcgtccaccggcgactgg
atgcgcctcaacaacgccgtcatggtgttcgaccggggccacccgctgctccgcgagttc
atcgctgagttcgccgccaagttcgacggcagcaagtggggccacaacgggccgtacctc
gtgtcgagggtggcggcgaggtggcgtcgccgccggaggccggaggcggaggctgacctg
acggtgctgccgccggcggcgttctaccccgtcgactggaacaagatcggcgggctgttc
gttgcacccaaggacaggaagggcgagaggtgggtgaaggccaaggttgagagcatcaaa
ggtgagagctttggcatccatctgtggaacagggagagcaggagcctggaaatggaggag
ggcagtgtgattggaaggttactctcagacagctgcttgttctgcaattcctccatgttt
gcaaagtatgaatag

DBGET integrated database retrieval system