KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336581
Entry
4336581           CDS       T01015                                 
Name
(RefSeq) probable isoaspartyl peptidase/L-asparaginase 3 isoform X1
  KO
K01444  N4-(beta-N-acetylglucosaminyl)-L-asparaginase [EC:3.5.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4336581
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.26  N4-(beta-N-acetylglucosaminyl)-L-asparaginase
     4336581
SSDB
Motif
Pfam: Asparaginase_2 G_glu_transpept
Other DBs
NCBI-GeneID: 4336581
NCBI-ProteinID: XP_015635754
UniProt: Q0JB91 A0A8J8XC19
LinkDB
Position
4:complement(27494011..27498043)
AA seq 387 aa
MGRSRRSYARLLLLGFLLLRFSWCLAVADDGGGAEEGGGIFPVVVSTWPFREAVRAAWEV
VSASGGAGCSAVDAVVAGCSACEVLRCDGTVGPGGSPDENGETTLDALIMDGTTMEIGAV
AAMRYVKDGIRAAKLVMDHTEHTLLVGEKATSFAISMGLVGPADLSSPESIGKWTIWRQN
HCQPNFWKNVVPAGSCGPYNAIDVPSGESKASAKRVLERTQGDICQGLFEPNNLLEPMNS
RLKIVNRHNHDTISMAVIDKMGRIAAGTSTNGATFKIPGRVGDGPIPGSSAYADDEVGAC
GATGDGDIMMRFLPCYQVVESMRRGMEPRDAAMDAILRIARKYPDFVGAVFAINKKGVHA
GACHGWTFQYSVRNSSMQDVEVITVSP
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgggaaggtcacggaggagctacgcgcggcttcttctcctagggttcctactgctacgg
ttcagctggtgcttggcggtggctgatgacggcggaggcgcggaggaagggggagggatt
tttccggtggtggtgagcacctggcctttccgggaggcggtcagggcggcctgggaggtg
gtgtcagccagtggcggcgcaggttgttcggccgtggatgccgtcgtcgccggctgctcc
gcctgcgaggtgctccgctgtgatggcacagttggcccaggtggaagcccagatgagaat
ggtgaaactacattagatgctctcatcatggatgggaccacaatggaaatcggagctgtc
gctgccatgagatatgtaaaggatggaatcagagcggcaaagttggttatggaccatact
gaacatactcttcttgttggagagaaggcaacatcctttgcgatttcaatgggacttgtg
gggccagctgatctgagctcaccggagtctatcggaaaatggacaatttggagacagaac
cattgtcaacctaacttctggaaaaatgttgttcctgctggtagctgtggcccgtacaat
gctattgatgtaccatcaggggagtctaaggcctctgccaaacgtgtgctagagcggact
cagggggacatttgtcaaggattatttgaacctaataatttactggagccaatgaactcc
cgtctaaaaatcgttaatcgccacaaccatgatacaatctctatggctgtgattgacaag
atgggtcgcatagcggctggcacatcgaccaatggtgctacattcaaaattccaggaagg
gtaggtgatggaccaataccaggatcttctgcatatgctgatgatgaagttggtgcatgt
ggagcaactggtgatggtgatattatgatgcgcttccttccgtgttatcaggtagtagag
agcatgcgacgagggatggagcctcgggatgctgccatggatgctatattaagaattgcc
cgcaagtacccggactttgttggtgctgtatttgcaattaacaagaaaggagtgcatgct
ggggcatgccacggatggacattccagtattctgtcaggaattctagcatgcaggatgtg
gaggtcatcactgtatcaccttaa

DBGET integrated database retrieval system