KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336595
Entry
4336595           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, cytoplasmic-like
  KO
K00025  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4336595
   00620 Pyruvate metabolism
    4336595
   00630 Glyoxylate and dicarboxylate metabolism
    4336595
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4336595
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4336595
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4336595
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N AMPK_alpha_AID
Other DBs
NCBI-GeneID: 4336595
NCBI-ProteinID: XP_015634484
UniProt: B9FGG9 Q7FAT9
LinkDB
Position
4:27605151..27608345
AA seq 352 aa
MMSSNSLFQRLAKWCPWLLRDEPKKPVKVLVTGAAGQIGYAIVAMIARGLMLGADQPVVL
HLLDLPVAANALNGVRMELIDAALPLLRGVVATSDEAEAFKGVNVAIVIGGWPRRDGMER
KDLISKNVTIYKSQASALHQHAAPNCKVLVVANPANTNALVLKEFAPAIPAKNITCLTRL
DHNRALGQVAEKLNVHVGDVKNAIIWGNHSSTQFPDASHATVSTDRGERPVRELIADEIW
LREEFVTDVQQRGAAVIKARKQSSSLSAASAACDHMRDWILGTPKGTWVSMGVYSDGSYG
VPEGVFFSFPVTCEKGEWSVVQGLEIDDFARSKMETSATELKEEKSIAYEFL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgatgtcatccaattccctcttccagcgtctggcaaaatggtgcccgtggttactgaga
gatgagccgaagaagcctgtcaaggttcttgtcaccggcgccgcagggcaaatagggtat
gccattgtcgcgatgatcgcgaggggcctcatgctaggagccgaccagccggtggtgctc
cacctgctggatctgccggtcgcggccaatgctctgaacggcgtcaggatggaactgatc
gacgctgcgctgccgctgctcagaggagtggtggcgacgagtgacgaggctgaggcgttc
aagggcgtcaacgtcgccatcgtcatcggtggatggccgaggagagacgggatggagagg
aaagatttgattagcaagaacgtgacaatctacaaatcccaggcctctgcgctccatcag
cacgccgccccaaactgcaaggtcttggtcgtggccaatcccgcgaacaccaacgcgctc
gtcctgaaggagttcgccccggcaatcccggccaagaacatcacctgcctcaccaggctc
gaccacaaccgcgccctcggccaggtcgccgagaagctgaacgtgcacgtcggcgacgtc
aagaacgccatcatatggggcaaccactcctccacgcagttccccgacgccagccacgcc
accgtctcgaccgaccgcggcgagaggcccgtcagggagctcatcgccgacgagatatgg
ctgagggaggagttcgtcaccgacgtgcagcagcgaggcgcggcggtgatcaaggcgcgg
aagcagtcgagctcgctgtccgccgccagcgcggcatgcgaccacatgagagactggatc
cttggaaccccaaagggtacgtgggtgtccatgggcgtttactctgacggcagctatggc
gtccccgagggcgtcttcttctcgtttccggtgacctgcgagaagggggagtggtctgtc
gtgcagggtcttgagattgacgactttgcacgctccaagatggaaacctcggcgaccgag
ctcaaggaagagaagtccattgcttatgagtttctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348905
Entry
4348905           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase, cytoplasmic
  KO
K00025  malate dehydrogenase [EC:1.1.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00012  Glyoxylate cycle
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4348905
   00620 Pyruvate metabolism
    4348905
   00630 Glyoxylate and dicarboxylate metabolism
    4348905
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4348905
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4348905
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4348905
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N 3Beta_HSD AMPK_alpha_AID GlcNAc-1_reg
Other DBs
NCBI-GeneID: 4348905
NCBI-ProteinID: XP_015614294
UniProt: Q7XDC8 A1YQK1 A0A8J8XV43
LinkDB
Position
10:17913821..17917768
AA seq 332 aa
MAKEPMRVLVTGAAGQIGYALVPMIARGVMLGADQPVILHMLDIPPATESLNGLKMELVD
AAFPLLKGIVATTDVVEACTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEAH
AAPNCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISEKLNVQVTDVK
NAIIWGNHSSTQYPDVNHATVKTPSGEKPVRELVADDEWLNTEFISTVQQRGAAIIKARK
QSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYGVPAGLIYSFPVTCSGGEWTIV
QGLPIDEFSRKKMDATAQELSEEKTLAYSCLN
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcgaaggaaccgatgcgcgtgctcgtcaccggcgccgcaggacaaattggatatgct
cttgtccccatgattgctaggggtgtgatgttgggtgctgaccagcctgttattctacac
atgcttgacattccaccagctactgaatctcttaatggccttaagatggagctggttgat
gctgcatttcctcttttgaagggaattgtcgcaacaactgatgttgtggaggcctgcact
ggtgtgaatgttgcggttatggttggtgggttccccaggaaggagggaatggaaaggaag
gatgttatgtcaaaaaatgtctccatctacaaatcccaagcttctgctcttgaggctcat
gcagcccctaactgcaaggttctggtagttgccaatccagcaaacaccaacgctctcatc
ttaaaagaattcgctccatccatccctgagaagaacattacttgcctcacccgtcttgac
cacaacagggcacttggccagatctctgaaaaacttaatgtccaagttactgatgtgaag
aatgcgatcatctggggcaaccactcatccacccagtaccctgatgttaaccacgccact
gtgaagactcccagtggagagaagcctgtcagggaactcgttgctgatgatgagtggtta
aatacggaattcatctctaccgtccagcagcgtggtgccgccatcatcaaggcgaggaag
caatccagtgccctatctgctgccagctctgcatgcgatcacattcgtgactgggttctt
ggcactcctgagggaacatttgtctccatgggtgtgtactctgatggttcgtatggtgtg
cctgctggtctgatctactcgttcccagtaacatgcagtggtggcgaatggacgattgtt
cagggtctcccgatcgacgagttctcaaggaagaagatggacgcgactgcccaggagctg
tcggaggagaagacgctcgcttactcatgcctcaactaa

DBGET integrated database retrieval system