KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337554
Entry
4337554           CDS       T01015                                 
Name
(RefSeq) methionine S-methyltransferase isoform X1
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00450  Selenocompound metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4337554
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     4337554
SSDB
Motif
Pfam: Aminotran_1_2 MTS Methyltransf_31 PrmA Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Met_10 Methyltransf_32 Methyltransf_4 tRNA_U5-meth_tr
Other DBs
NCBI-GeneID: 4337554
NCBI-ProteinID: XP_015639162
LinkDB
Position
5:complement(267956..278070)
AA seq 1090 aa
MGSAGVEDAAAVAAFLERCAPSGDAAYGELKAVLGRLHEPTTRRAARAFLTALRPFCSSG
DSLARYGFRIHDLSLLHCAHDHQFSGFQQRKKLTMMEIPSIFIPEDWSFTFYEGLNRHPD
SIFRDKTVAELGCGNGWISIALAEKWSPSKVYGLDINPRAVKIAWINLYLNALDDDGLPI
YDGEGKTLLDRVEFYESDLLSYCRDNKIELDRIVGCIPQILNPNPEAMSKIVTENSSEEF
LYSLSNYCALQGFVEDQFGLGLIARAVEEGISVIKPMGIMIFNMGGRPGQGVCERLFRRR
GFRITKLWQTKIMQAADTDISALVEIEKNSRHRFEFFMDLVGDQPVCARTAWAYMKSGGR
ISHALSVYSCQLRQPNQVKKIFEFLKDGFHEVSSSLDLSFDDDSVADEKIPFLAYLASFL
KENKYNPCEPPAGCLNFRNLVAGFMKSYHHIPLTPDNVVVFPSRAVAIENALRLFSPALA
IVDEHLTRHLPKQWLTSLAIEGKAKDTVTVIEAPRQSDLLIELIRKLKPQVVVTGMAQFE
AITSAAFENLLSVTKDVGSRLFIDISEHLELSSLPSSNGVLKYLAGKTLPSHAAILCGLV
KNQVYSDLEVAFAISEDAAVYRALSQTIELLEGHTSQISQHYYGCLFHELLAFQIADRHP
QQERLPAEVIPQKMIGFSSSAMSTLKEAEFFIPDSKKSSVIHMDLDRSFLPVPSAVNASI
FESFVRQNITESETDVRSSIQQLVKDSYGFPADGCSEILYGNTCLALFNKLALCCIQDQG
TLLFPLGANGHYVSAAKFVNANTLTIPTKLESGFKIEPRVLADTLETVSRPWVYISGPTI
NPTGFLYSDSDIQELLSVCGKYGARVVIDTSFSGLEFQTDGWSRWNLERCLSAVNCPKPS
FSVALLGELSFELTAAGHDFGFLILNDSSLVDTFHSFPSLSRPHSTLKYTFKKLLGLKNQ
KDEHFSNLIMEQKDTLKSRADHLIKTLEGCGWDVAGSHGGISMLAKPTAYIGKIIKVDGF
DGKLDGCNIKEAILRSTGLCINSSSWTGIPDHCRFSFALESSEFERAMGCIVRFKELVLG
SKAFHQINGN
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgggcagcgccggcgtggaggatgcagcggcggtggcggcgttcctggagcggtgcgcg
ccgtcgggagacgcggcctacggcgagctcaaggcggtgctggggcgcctccacgagccg
accactcgccgcgccgcccgcgccttcctgacggcgctccggcctttctgctccagcggc
gactcgctggcgcgctacggattccgcatccacgacctctccctcctccactgcgcccac
gaccaccaattctcaggattccagcagaggaagaagctaacgatgatggaaatacctagc
attttcattcctgaagactggtccttcactttctatgagggcctcaatcggcatccagat
tccattttcagggataagacagtagctgagctgggatgtggcaatggttggatatccatt
gcacttgcagaaaagtggtccccttcgaaggtctatggactggatataaacccaagagct
gtcaagattgcatggataaacctttacttgaatgcactagatgacgatggtctcccaatc
tacgacggggaggggaaaacattgctggatagagtagaattctatgaatctgatcttctc
tcttactgcagagacaataaaattgaacttgatcgcattgttggatgcataccacagatt
cttaacccaaatccagaagcaatgtcaaagatcgtaactgaaaattccagtgaggagttc
ttgtattcattgagtaactactgtgctcttcagggttttgttgaggaccaatttggcctt
gggttgattgctcgggctgttgaagaagggatatcagtcataaagcctatgggtattatg
atatttaacatgggtggtcgaccaggacaaggtgtctgcgaacgactatttcgacgccgt
ggatttcggatcacaaaactgtggcaaacaaaaattatgcaggctgctgacacagatatt
tcagctttagtggaaattgagaaaaatagccggcatcgctttgagtttttcatggatctt
gttggggatcagcctgtctgtgcacgcacagcttgggcatacatgaaatctggtggtcgt
atttcacatgctttgtcagtgtatagctgtcaacttcgccaacccaaccaggtgaagaaa
atatttgagtttcttaaagatgggttccatgaagtcagcagctccctggatttgtctttt
gatgatgattctgttgctgacgaaaaaatacccttcctagcatacctagctagttttttg
aaggagaataaatacaatccttgtgaaccaccagctggttgtctaaacttccggaatctt
gttgctggatttatgaagagctaccaccatatcccattaactcctgataatgttgttgtt
ttcccttcccgtgctgtggcaatagaaaatgctcttcgattattctcaccagcgcttgcg
atcgttgatgaacatctgaccagacacttgccaaagcaatggttaacttctttagcaatt
gagggaaaagccaaagatacagttactgtaattgaggcaccacgccaatctgatttgttg
attgagttgatcaggaaactgaagcctcaggtggttgttactggcatggctcagtttgag
gctatcacaagtgctgcttttgagaacttattaagtgtaacgaaggatgttggttctcgg
ttattcatcgatatttcagagcatctggagttgtctagtttgccaagctctaatggtgta
ttaaaataccttgctggaaagaccctaccttcccatgcagctatactatgcggtttagta
aagaatcaggtttattctgatctggaggttgcttttgccatttctgaagatgcagctgtt
tatagggcattatcacaaactattgagctattggaagggcatacgtctcagatcagccag
cactattatggttgtcttttccatgagctactggcatttcaaattgctgatcggcatcca
caacaagaaagactgcctgcagaagtgatacctcagaagatgataggattttcaagttca
gctatgtctaccctaaaagaagctgaatttttcattcctgactccaaaaaatccagtgtc
attcatatggatttagatcgcagcttcttgccagtgccttctgcagtgaatgcctccatt
tttgaaagttttgttaggcagaacattactgagtctgaaactgatgtccgttccagcatt
cagcagctggtgaaagatagctatggtttcccagcagatggttgttctgaaatattatat
ggcaacacctgtcttgcactcttcaacaagcttgccctttgctgcatccaagaccagggc
accttacttttccccttgggcgctaatggtcactatgtctcagcagcaaagtttgtgaat
gcaaatacgctgactattccgacaaagttagaatcaggcttcaagattgaaccacgggtt
ctagctgacacacttgagacagtatctaggccatgggtttatatttctggccccacaatt
aaccctactggtttcctgtacagtgacagtgatattcaagagctcctttctgtttgtggt
aaatatggagctagggtagtaatagatacctccttctctggtctggaattccaaactgat
ggctggagtcgatggaatttggaaagatgtctttctgctgtgaattgtccaaaaccctcg
ttctctgtagctcttctcggagaactgtcctttgagctgactgctgcagggcatgacttt
gggtttctgattttgaatgactcatccttggttgacacatttcacagtttcccaagcttg
agtcgtccccacagtacgctgaagtacactttcaaaaaactactgggcctcaagaatcag
aaggatgaacacttctccaatctcattatggagcagaaggacacactaaagagtcgtgct
gaccacttgataaagacacttgagggctgtggctgggatgttgctggcagtcatggtggc
atatcgatgctggcgaaaccgactgcctacatcggcaaaataatcaaggtggatggtttt
gatggcaagctagatggctgcaacatcaaggaagccattctcaggtccaccgggttgtgc
ataaacagcagctcatggacaggaataccggatcactgtcggttcagctttgctctggag
agcagcgaattcgagcgtgcaatgggctgcatagttcgcttcaaggagttggttcttgga
agcaaggcttttcatcagatcaatggtaactaa

DBGET integrated database retrieval system