KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338088
Entry
4338088           CDS       T01015                                 
Name
(RefSeq) mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3
  KO
K23741  endoplasmic reticulum Man9GlcNAc2 1,2-alpha-mannosidase [EC:3.2.1.209]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4338088
   00513 Various types of N-glycan biosynthesis
    4338088
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4338088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4338088
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.209  endoplasmic reticulum Man9GlcNAc2 1,2-alpha-mannosidase
     4338088
Membrane trafficking [BR:osa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    4338088
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 4338088
NCBI-ProteinID: XP_015639934
UniProt: Q0DK00 A0A0P0WJ66
LinkDB
Position
5:complement(6752392..6756389)
AA seq 645 aa
MSGGGGGSGPLPYSMRDVDGRGAYNNAKFRHRSRLKMASQALFTNSSKYQCGKFTVGKFL
SLLMVSGVIYLLVHKSSDGFVSGELHEKVGNTHTKKDFPKIRTFWRKPPRLPPRLPPNEI
YRNNSLLLQSPQSEWTLRQKKVKEAFEHAWSGYRNYAMGYDELMPLTRRGIDGLGGLGAT
VVDSLDTAIIMGADDVVSEASKWIEDNLMKKLSEKGQVNLFETTIRVLGGLLSAYHLSGG
DKARGDSGIPMTSKRANPERLLEVSKDLADRLLLAFTSSPTAIPLSDVVLRDRTAHAAPD
GLSSTSEATTLQLEYSYLSTISGDPKYDLEAMKVLEHMRTLPTVEGLVPIYINPSSGQFS
GENIRLGSRGDSYYEYLLKVWVQQERYRDTSLKYLFEMYTEAMKGVKHLLVRKTIPNGLV
FVGELPYGRNSGFSPKMDHLVCFLPGTLALGATKGITKKKALENHLLTAEDIDNLQLAED
LAKTCVEMYFVTSTGLAPEIAYFHIEGNSEGGPDGGNKSSQYVNDIIIKPLDRHNLLRPE
TVESLFVLYRITEDPKYREWGWQIFQAFEKYTRVDSGGYTSLDDVTSLPPPRRDKMETFF
LGETLKYLYLLFGESNILPLDKYVFNTEAHPLPIIQSAQQISHSV
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgagcggcggcggcggcggctcgggccccctcccctactcgatgcgcgatgtggacggc
cgcggcgcctacaacaacgccaagttccgccaccgatctcgcctcaagatggcctctcag
gctctgtttaccaatagcagcaagtaccaatgtggaaagttcactgttggaaaatttttg
agtcttttaatggtttctggcgtaatatacttacttgtgcacaaaagttcggatggtttt
gtatccggtgagctccatgaaaaagtagggaatacacataccaagaaagattttcccaaa
attcgtacattttggagaaagccaccaaggctgccgccacgtcttcctccaaatgaaatc
tatagaaacaattcattgcttctacagtctcctcaatctgaatggacactcagacagaag
aaagttaaagaagcatttgaacatgcatggtctggctatcgaaattatgcaatgggttat
gatgagcttatgcctttaacccgccgaggtatagatggactaggaggtctaggcgctact
gttgtagattctttagacactgcaataataatgggtgctgatgatgttgtttccgaagca
tcaaaatggattgaagataatctcatgaaaaagttaagtgagaaagggcaggtcaatcta
tttgaaactactatccgtgtcttgggagggcttcttagtgcctatcacttgagtggtggt
gacaaagcaagaggtgactctgggataccaatgacatctaaaagggctaatccggagcgt
cttttggaagtttcaaaggacttggcagacagattattgttagcctttacatcaagccca
actgctatacctttaagtgatgttgttcttcgagatcgaactgcacatgcagcccctgat
ggtttaagcagtacctctgaggctacaacattgcagctggagtacagttaccttagcaca
atatcaggagatccaaagtatgacttagaggcaatgaaagtgttagagcatatgcgaaca
ctcccaacagtggagggtttggttcctatttacatcaatccctcctctggtcaatttagt
ggagaaaatattcgattaggatctcgtggtgacagttactatgaatacctattgaaagta
tgggttcagcaagaaagatatcgtgacactagtttgaagtatctatttgaaatgtataca
gaagcaatgaaaggggtcaagcatcttcttgttcgaaaaactattccaaatgggctggtc
ttcgttggggagctcccctatggacgaaatagtggttttagccctaaaatggatcacctg
gtgtgttttcttcctggtacccttgctctgggtgcaacgaagggtataaccaagaaaaaa
gctcttgaaaatcatttattgactgcggaagacatagacaatctgcagcttgctgaagat
ttggccaaaacttgtgttgaaatgtactttgtgacatctactggacttgctcctgaaatt
gcttattttcacattgagggtaattctgagggaggacctgatggtgggaacaaaagttct
caatatgttaatgatatcataatcaaacctctggatcgtcacaatcttttacgcccagag
actgtagaatcactatttgttttatatagaatcacagaggatccgaagtatagggaatgg
ggttggcagatttttcaggcttttgagaagtatacaagagttgattctggtggctatact
tcattggatgatgtcacaagcttgcccccacctaggagagacaaaatggaaactttcttc
cttggagaaacactgaaatacttgtatttgctgtttggtgaaagcaatattcttccatta
gataagtatgtattcaacacagaggcccatccacttccaatcattcagtctgcacaacag
atctctcattcggtatag

DBGET integrated database retrieval system