KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339844
Entry
4339844           CDS       T01015                                 
Name
(RefSeq) homogentisate 1,2-dioxygenase isoform X2
  KO
K00451  homogentisate 1,2-dioxygenase [EC:1.13.11.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa01100  Metabolic pathways
Module
osa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4339844
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.5  homogentisate 1,2-dioxygenase
     4339844
SSDB
Motif
Pfam: HgmA_N HgmA_C
Other DBs
NCBI-GeneID: 4339844
NCBI-ProteinID: XP_015643393
UniProt: Q5VRH4
LinkDB
Position
6:complement(215106..218288)
AA seq 470 aa
MAMATATPAAQNEQQEKGGLEYVYLSGLGNSLSSEAVAGTLPRGQNSPLVCPLGLYAEQL
SGTPFTAPRARNLRTWLYRIKPSVTHEPFHPRRPAHPRLIGDFDRTTTDTVATPTQLRWR
PADVPPHHPPLDFIDGLYTVCGAGSSFLRHGYAIHMYAANKSMDGCAFCNADGDFLIVPQ
QGKLLITTECGKLLVPPGEIVVIPQGFRFAVDLPDGPSRGYVSEIFGTHFQLPDLGPIGA
NGLASARDFLSPTAWFEQVHRPGYTIVQKYGGELFTATQDFSPFNVVAWHGNYVPYKYDL
SKFCPFNTVLFDHADPSVNTVLTAPTDKPGVALLDFVIFPPRWLVAENTFRPPYYHRNCM
SEFMGLIYGIYEAKADGFLPGGASLHSCMTPHGPDTKTYEATISRPDANEPSRLSGTLAF
MFESALIPRVCQWALDSPSRDLDYYQCWIGLKSHFSHDNGGATSEEPCRK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggccatggcaacggcaacccccgcggcgcagaatgagcagcaggagaagggggggttg
gagtacgtatatctgtcggggctgggcaacagcttgtcgtcggaggcggtggcggggacg
ctcccgcgcgggcagaacagcccgctggtctgcccgctgggactctacgccgagcagctc
tccggcacgcccttcaccgccccgcgcgcccgcaacctccgaacatggctgtaccggatc
aagccttcggtgacccacgagcccttccacccccgtcgccccgcccacccccgcctcatt
ggggatttcgaccgcaccaccaccgacaccgtcgccacgcccacccagctgcgctggcgc
cccgccgacgtgcccccccaccatcctcccctcgatttcatcgatggcctctacaccgtc
tgcggcgctggcagctccttcctgcgccacggatacgccatccacatgtacgctgctaac
aagtccatggacggatgcgccttttgcaacgctgacggcgatttcctcattgtcccccag
caaggaaagctgttgatcacaactgaatgtgggaagctgctagtcccacctggtgaaatt
gttgtcattccccagggttttcgctttgctgttgatttgcccgatggtccttcacgtggc
tatgtttctgagattttcggtacccactttcagctccctgatcttggcccgattggtgca
aatggcttggcttcggcaagggatttcctttccccaacagcatggtttgagcaagtccac
cgcccaggatacacaattgtgcagaaatatggtggtgagctattcactgccactcaggac
ttttctccatttaatgtggtagcgtggcatggaaattatgtcccttacaagtacgacctg
agtaaattctgtccatttaacactgttctattcgatcatgctgatccatcagtaaataca
gtgctgactgcaccaactgataagcctggtgtcgcattgcttgattttgtgatattcccg
cctagatggttggtcgctgagaacacatttcgccctccatactatcatcgcaattgcatg
agtgaatttatgggattgatctatggaatatacgaggccaaagctgatggttttcttcct
ggaggtgctagccttcacagttgcatgacacctcatggcccagacaccaagacatacgag
gcaacaatcagccgtcctgatgccaatgagccatcaaggctaagcggcacgcttgcattc
atgttcgagtctgcactcatccccagggtttgccaatgggccctcgattccccatcccgg
gatctcgattactaccagtgctggattggattgaaatcccacttctcacatgacaatgga
ggggcaaccagcgaagaaccatgcagaaagtag

DBGET integrated database retrieval system