KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340636
Entry
4340636           CDS       T01015                                 
Name
(RefSeq) alpha-mannosidase 2
  KO
K01231  alpha-mannosidase II [EC:3.2.1.114]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4340636
   00513 Various types of N-glycan biosynthesis
    4340636
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.114  mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
     4340636
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid CbtA
Other DBs
NCBI-GeneID: 4340636
NCBI-ProteinID: XP_015643335
LinkDB
Position
6:complement(7563723..7571100)
AA seq 1184 aa
MPFFSGGGGGRSGALLPTTSKPKGHHHLRSKGLSSPAASRRRGAHSASSSASSSSRRRVL
YVAAAAFAALFLLAFFRLGLPSSRPAATSPARLRPRLTRRPAFRRDSAAAEAAAAAVAAR
IGREAHVDITTKDLYDRIQFLDVDGGAWKQGWEVSYKSDEWDGEKLKVFVAPHSHNDPGW
RLTVEEYYEKQSRHILDTIIESLSKDSRRKFLWEEMSYLERWWRDAPRKKQEAFTKLVRD
GQLEIVSGGWVMNDEANSHYFAIIEQMMEGNMWLNDTIGVVPKNSWSIDPFGYSATMAYL
LRRMGFHNMLIQRTHYELKKELAMNKNLEYLWRQNWDIDETTDIFVHMMPFYSYDIPHTC
GPEPAICCQFDFARMRSFSYESCPWRFDPVETNANNVQERAMKLLDQYRKKSTLYRTNTL
LIPLGDDFRYVSTEEAEAQFRNYEKLFDYINSNPHLKAEVKFGTLEDYFSTLRDEAERIN
YTRPGELVSSELPGFPTLSGDFFTYADRNQDYWSGYYVSRPYFKAVDRVLEQTLRASEIL
SSFVLGYCQKLQCVKLPISFSHKLTAARRNLALFQHHDGVTGTAKDHVVVDYGTRMHTSL
QDLQLFMSRAVEVLLGDIHDRSDPTLLSHFEPVQERSKYDVQPVYKVLNPHGGKAHSVVL
FNPLEQTRDEIVMVVVSNPDVSVLNSNGSCLRSQISPEWQYVSGEKVSTGQHRLYWRASV
PALGLETYYVATGYDDCAKATPAVVKAFTTAGQFPCPEPYVCSKLEGKTVEMKNSYHSLS
FDVRHGLLQTVTRNKDGEHTDVGEEIGMYRSHGSGAYLFKPIGEAQSIVEEGGYFILSEG
PLVQEAHSLPKTQWHKSPISHSTRIYSCGDSIQDMLIEKEYHVELVGHVFNDKELIVRFK
TDIDNQGVFYSDLNGFQMSRRQTYDKIPLQGNYYPMPSLAFLQDSLGNRFSVHSKQSLGA
ASLKNGWLEIMLDRRLTQDDGRGLGQGVVDNRPMNVIFHLLRESNVSALPKTHSLLTLQP
SLLSHRVGAHLNYPMHAFVSKKAQEKSFKLAQQTFAPLTSPLPCDVHVVNLKAPQPLKFH
HAEAVEARFALLLQRRGWDASFCRRGGLNCTTIGEEPVNLFYMFKDLAVLDVKATSLNLL
HDDPEMLGYLEQIGDVAQEGNVLISPMDIQAYKLDLQPPSSQEE
NT seq 3555 nt   +upstreamnt  +downstreamnt
atgccgttcttctccggcggcggaggcggccgctcgggcgcgctcctcccgacgacctcc
aagcccaagggccaccaccacctccgctccaagggcctctcctccccggccgcctcccgc
cgccgcggggcccactccgcctcctcgtcggcctcctcctcctcccgccgccgcgtcctc
tacgtcgcggccgccgccttcgccgccctgttcctcctcgccttcttccgcctcggcctc
ccctcctcccgccccgccgcgacctccccggcccgcctgcgcccgcgcctcacccgcagg
ccggccttccgccgcgactcggctgcggcggaggcggccgccgccgccgtggccgcgcgg
atcggccgcgaggcgcacgtggacatcaccaccaaggacctgtacgaccggatccagttc
ctggacgtggatggcggcgcgtggaagcaagggtgggaggtctcctacaagagcgacgag
tgggacggcgagaagctcaaggtgtttgtcgcgccccactcccacaacgaccccggatgg
cgtctcaccgtcgaggagtactacgagaagcagtcgcgccacatcctcgacaccatcatc
gagtcgctctccaaggattcgcgtaggaaatttttatgggaggagatgtcatacctggag
aggtggtggcgcgacgcccctcggaagaagcaggaggcgttcaccaagcttgtgcgtgat
ggacagctggagattgtcagtggagggtgggtcatgaatgacgaggcaaactcccactat
tttgctatcatagagcagatgatggagggaaacatgtggctcaatgataccattggagtt
gttcctaaaaattcttggtcaattgatccatttggttattcagctaccatggcttatctg
ctgaggagaatgggtttccacaacatgttaatccagcgaacgcattatgaattgaaaaag
gagcttgcgatgaataagaaccttgaatatttatggaggcagaactgggatatagatgaa
acaactgatatatttgttcatatgatgcccttctattcttatgacattccacacacctgt
ggaccagaaccagctatctgctgccagtttgactttgctcgaatgcgtagcttcagctat
gaatcttgcccgtggagatttgatccagttgaaacaaatgctaacaatgtgcaagagagg
gcaatgaaacttctagatcaatacaggaaaaagtctacgctgtacagaacaaatacactt
ctcattccattgggggatgatttccggtatgttagtacagaggaagcagaagcacagttc
cgcaattatgaaaagctttttgattacataaactctaatccccatcttaaggctgaagta
aaatttggtaccctggaggattacttctccacgctgagagatgaagctgaaaggataaac
tatacacgccctggtgaactggtttcttctgagctgccaggttttccaacactttcaggt
gatttctttacatatgctgatagaaatcaggattactggagtggttactatgtatcaagg
ccgtacttcaaagcagttgaccgagtactagaacagacactacgtgcctcagagattctg
agttcttttgttctaggatactgtcagaagcttcaatgtgtaaaactccccatcagcttt
tctcacaagctaacagcagctaggaggaacctggcactcttccagcatcatgatggtgta
actggcacagctaaggatcatgttgtagtggactatgggactcgaatgcacacttctttg
caagacttgcagctctttatgtccagggcggttgaagtgcttttaggtgatatccatgac
agatctgatcctaccttactatcgcattttgagccagtgcaggaacggtcaaaatatgat
gttcaacctgtatacaaggttctcaaccctcatggagggaaggcacattctgttgtcctt
tttaacccattagagcaaacaagggatgagattgttatggttgttgtaagtaatcctgat
gtatctgttctcaattcaaatggttcctgtttgagaagtcaaatttcccctgagtggcag
tatgttagtggcgaaaaggtttctactggccagcaccgtctttattggagagcttctgtt
cctgctcttggtttggagacctactatgttgctactgggtacgacgattgtgcaaaggcg
actccagctgtggtgaaggcattcacaactgctgggcaatttccttgccctgaaccatat
gtttgttcaaaactggaaggaaaaacagtggagatgaagaactcttaccactctctctct
tttgatgtaaggcatggcctcctccagacagtaactcgcaacaaggatggggaacacacc
gatgttggtgaagaaattggcatgtaccgcagccacggtagtggggcatacttgttcaaa
ccaataggggaagcacaatccattgttgaggaagggggatatttcatccttagtgaaggg
ccattggttcaagaggctcattcccttccaaagacacagtggcataagtcacccatctca
catagcacacggatttatagctgtggagactctatacaggatatgctgattgagaaggaa
taccatgttgaacttgttggccatgtatttaatgacaaggagttgattgtcagattcaag
acagatattgacaaccaaggagtcttctattctgatctaaatggctttcagatgagtagg
aggcagacatatgataagatccctttgcagggcaattactacccaatgccatcacttgca
tttttacaggattcgctgggcaatcggttttcagtacactccaagcagtcactaggggca
gcaagcttaaaaaatggatggctggagattatgttggatcgtagactaactcaggacgat
ggtcgtggtctgggccagggagtggtggacaaccggcctatgaatgtaatcttccacctc
ctcagggagtcaaatgtttctgccttgcctaaaactcacagcttgctaactctacaacca
tctcttctctcccaccgtgtgggtgcacacctgaactacccaatgcatgcttttgtgagc
aaaaaagctcaagaaaaatcgttcaagcttgctcaacaaacatttgctccattaacttct
cctttgccctgtgatgtacatgttgtgaacttgaaggcccctcagcctctaaaatttcac
catgctgaagcagtcgaagcaagatttgcccttctgttgcagcgaagaggctgggatgca
tcattctgcagaaggggcggattaaactgtacaactattggagaagagcctgtgaatttg
ttctacatgttcaaagatctggccgttctggatgtgaaggcaacttctctgaatctctta
catgatgaccctgaaatgctagggtaccttgagcaaattggtgatgtagctcaggaggga
aacgttcttatctcaccaatggacattcaggcatacaagctggacctacagccaccatca
tcacaggaagagtag

DBGET integrated database retrieval system