KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341801
Entry
4341801           CDS       T01015                                 
Name
(RefSeq) molybdenum cofactor sulfurase
  KO
K15631  molybdenum cofactor sulfurtransferase [EC:2.8.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4341801
Enzymes [BR:osa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.9  molybdenum cofactor sulfurtransferase
     4341801
SSDB
Motif
Pfam: MOSC Aminotran_5 MOSC_N
Other DBs
NCBI-GeneID: 4341801
NCBI-ProteinID: XP_015644048
UniProt: Q655R6
LinkDB
Position
6:27749118..27756347
AA seq 824 aa
MEVSKEEFLRQFGGDYGYPGAPKGVDEMRAAEFKRLEGMAYLDHAGATLYSEAQMADVLK
DLASNVYGNPHSQSDSSMAASDLVTAARHQVLKYFNASPREYKCIFTSGATAALKLVGEC
FPWSRESCYMYTMENHNSVLGIREYALSKGATVLAVDVEEGADLAKDNGSYSLYKISRRT
NQRRSKDVLSHNCQNGSLSDISGNNWNIFAFPSECNFSGQKFSLSLVKLIKEGKIPLQQQ
GKWMVLIDAAKGCATEPPNLTVYPADFVVCSFYKIFGYPTGLGALIVKNEAANLLNKTYF
SGGTVAASIADIDFVQKRKNIEQVLEDGTISFLNIASLRHGFKIIEMLTTSAIERHTTSL
ATYVRNKMLDLKHSNEINVCTIYGQQYSKVEGLKMGPTITFNLKREDGSWFGYREVEKLA
SLFGIHLRTGCFCNPGACAKYLGLSHSDLVSNFEAGHVCWDDNDIINGKPTGAVRISFGY
MSTFEDAEKFLKFLQSSFVSLPVQFNNGYMLNLNSLNLIDNSSQKAVSDIHLKSIIIYPV
KSCQGFSVKSWPLTTGGLMYDREWLLQGSGGEILTQKKVPELGSIRTLIDLELGKLFIES
PTRRDKLQLSLLESLADLSEEVDVFGQRYEVQSYDDRVNTWFSEAIGRPCTLVRCSSSKY
RSCTYTGLRDRPCRDTQSKLNFVNEGQLLLISEESISDLNSRLNSGKGDCKQKLPVDAMR
FRPNLVISGSSPYSEDNWKKLRIGEACFTSMGGCNRCQMINLHQDSGQVLKSKEPLATLA
SYRRKKGKILFGILLNYEDIMEGENETIAGRWLQVGQQVYPSTE
NT seq 2475 nt   +upstreamnt  +downstreamnt
atggaggtgagcaaggaggagttcttgaggcagttcggtggcgactatggctacccgggc
gcgcccaagggcgtcgacgagatgcgcgccgccgagttcaagcggcttgaagggatggct
tacctggaccatgccggtgcgacgctgtattcagaggcgcagatggcggatgtcttgaaa
gaccttgcatccaatgtatatgggaacccacatagtcagagtgattcaagcatggctgcg
agtgacctcgttactgctgcacgccatcaggttttaaaatacttcaatgcatctcccaga
gaatacaagtgcatatttacctctggggcaacagcagctctgaaacttgttggtgaatgt
tttccatggagtagagaaagctgttacatgtacacgatggagaatcacaatagtgtgctt
gggataagagaatatgctctgagtaaaggagctactgtgttggccgttgatgttgaggag
ggtgctgatctggcaaaagacaatggaagttatagtttgtataagatttcaagacgcaca
aaccaaagaagaagcaaagatgtgctttcacacaattgtcagaacggaagtctttcagat
atttcagggaacaattggaatatatttgcattcccgtcagaatgcaatttttcaggacaa
aagttcagtctgagcttggttaagctcatcaaggaaggaaaaatcccattgcagcagcag
ggtaaatggatggttctgatagatgctgcaaaaggatgtgccactgaaccaccgaattta
actgtgtatcctgctgattttgttgtatgttccttctacaagatatttggctatccaact
ggccttggtgctctaattgtaaaaaatgaggctgctaatctgttgaacaagacatatttt
agtggaggaaccgtagctgcttcaattgctgacatcgactttgttcaaaaaagaaagaat
atcgaacaggttctagaggatggaacaatctcgttcttgaacatagcttctctccgacat
gggtttaagatcattgaaatgctcactacctctgcaattgaacggcatactacatccctt
gctacttatgtgagaaacaaaatgctggacctgaagcacagtaatgagataaatgtttgc
acaatatatggacaacagtattccaaggtggaaggtctgaaaatgggccctacaatcaca
ttcaatttgaaaagagaagatggctcttggtttggataccgtgaggtggagaagcttgct
tccttgtttggaatacatttgcgtactggctgcttctgtaaccctggcgcttgtgctaag
tatcttggactgtcccattcagatttagtttctaattttgaggctgggcatgtttgctgg
gatgataatgacataataaatggaaagccaactggtgctgtcaggatatcatttgggtac
atgtccacatttgaagatgcagagaaattcctgaagttcctgcagtcctcttttgtatcc
ctaccagtacaattcaacaacgggtacatgttgaatctgaacagtcttaacttaatagat
aattcgagtcaaaaggctgtttcagatattcacttaaaatccataattatttatcctgtg
aaatcatgccaaggatttagtgtaaagagttggccactaaccactggtggcctaatgtat
gatagagaatggcttctccaagggtcaggaggtgaaattttgacacagaaaaaggtgcca
gagttgggctcaatccgcacattgatagacctggaacttgggaaactcttcatagagtct
cccacacgcagggataaattgcaactctctcttcttgagagtttggctgatctaagtgaa
gaagtagatgtatttggtcagaggtatgaggtgcaaagttacgatgatagggtaaacaca
tggttcagtgaagctattggacgtccttgtaccttggtgagatgctcaagctccaagtac
cgttcctgcacatatactggcttgagagatcgtccatgtagagatactcaaagcaaactt
aattttgttaatgaaggacaactactactaatatcagaagaaagcatctctgacctcaat
agtcggctaaattcaggcaaaggggactgtaagcaaaagttgcctgttgatgcaatgaga
ttccgtcccaaccttgttatctctgggtcgagtccatacagtgaggataactggaaaaaa
cttcgtatcggagaggcctgttttacgtccatgggaggatgcaatcgctgtcagatgatc
aatctacaccaggactccgggcaggtgctcaaatcaaaggaaccattggccactttagcg
tcatacagacgaaaaaagggcaagattttgttcggcatcctattaaactatgaagacatt
atggaaggggaaaatgagaccattgcagggagatggctccaagtggggcaacaagtgtac
ccttccacagaatga

DBGET integrated database retrieval system