KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341967
Entry
4341967           CDS       T01015                                 
Name
(RefSeq) UDP-sugar pyrophosphorylase
  KO
K12447  UDP-sugar pyrophosphorylase [EC:2.7.7.64]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00052  Galactose metabolism
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4341967
   00052 Galactose metabolism
    4341967
   00053 Ascorbate and aldarate metabolism
    4341967
   00520 Amino sugar and nucleotide sugar metabolism
    4341967
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.64  UTP-monosaccharide-1-phosphate uridylyltransferase
     4341967
SSDB
Motif
Pfam: UDPGP PDZ_1 DUF5027
Other DBs
NCBI-GeneID: 4341967
NCBI-ProteinID: XP_015644365
UniProt: Q5Z8Y4
LinkDB
Position
6:complement(29508829..29515165)
AA seq 616 aa
MASDGDGAAAVAALGISGGGGDDWAPPLRRNLPLLAPHEVKLAKLLLSEGQSHLFEHWPE
PGVDDDKKRNFFDQVCRLNSSYPGGLASYIQNARKLLADSKAGKNPYDGFSPSVPSGEVL
TFGDDNFVSLEEAGVKEARHAAFVLVAGGLGERLGYKGIKVALPRETTTGKCFLQHYIES
ILALQEASCKLVEGECNTKIPFVIMTSDDTNALTVKLLESNSYFGMEPSQVHILKQEKVA
CLADNDARLALDPNDKYKIQTKPHGHGDVHALLYSSGLLEQWKSTGRKWVLFFQDTNGLL
FNAIPSALGVSATKGYNVNSLAVPRKAKEAIGGITKLTHVDGRTMVINVEYNQLDPLLRA
TGHPDGDANCETGYSPYPGNINQLILEIGPYMEELQKTHGAISEFVNPKYTDSTKTAFKS
STRLECMMQDYPKTLPPSAKVGFTVMDAWLTYAPVKNNPEDSAKVPKGNPYHSATSGEMA
IYRANSLILRKAGAQIADPVIDTFNGQEVEVWPRITWIPRWGLIFKDVKAKVHSNSSVSQ
RSALVINGKNITIQGLSLDGTLIVNAKDEAKFNVTGHIENKGWTIQHVDHKDTSEKEEIR
IRGFKFNKVEQLELNY
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggcttccgacggcgacggcgccgcggcggtggcggcgctggggatctccggcggcggg
ggcgacgactgggcgccgccgctgcggcggaatctcccgctgctcgcgccccacgaggtt
aagcttgcaaaattgctgctgagtgaaggacagtcacatttgtttgaacactggccggaa
ccaggtgttgatgatgacaagaaaaggaacttctttgaccaggtctgccgccttaattca
agctatcctggtgggctggcatcgtacatccagaatgcaagaaagcttttagcagattca
aaggcaggaaaaaatccatatgatggcttctcaccttctgttccttcaggggaagtattg
acctttggtgatgacaactttgtttcgcttgaagaagctggggtaaaagaagcccgccat
gcagcatttgttcttgtagctggtgggcttggtgaaagacttggttacaaaggaattaag
gttgcacttcccagggaaacaactactggaaaatgctttcttcaacattacatagaatct
attctagctttgcaggaggcgagctgcaaattggtagagggtgaatgcaatacaaagatc
ccatttgttattatgacttctgatgacacaaatgcactaaccgtcaaacttttggagtca
aactcctattttggaatggaaccatcacaagtgcacattcttaagcaggaaaaagtggca
tgtttagctgataatgatgcaaggcttgcattagacccaaatgacaagtacaaaatccag
acaaagccacatgggcatggagatgtccacgctcttctttattcaagcggcttgcttgag
caatggaagagcacagggcggaaatgggttctctttttccaggacacaaatggattgctc
ttcaatgcaataccatcagcattaggtgtcagcgccaccaaaggttataatgttaattct
cttgcagttccacggaaggcaaaagaagccattggaggaataacaaaacttactcatgtc
gatggtagaacaatggtcatcaatgtcgagtacaatcagcttgatccactccttcgtgca
accggacatcctgatggagatgcaaattgtgaaacagggtactctccataccctggaaat
ataaaccagttgatactggagattggaccatatatggaggagctccagaaaacacacggt
gccatttcggaatttgtaaaccctaagtatactgattctaccaagacagcatttaaatcg
tccactcgtcttgagtgcatgatgcaggactatccaaaaacactacctccctctgcaaaa
gttggatttacggtgatggatgcgtggcttacttatgctcctgtaaagaataatcctgaa
gattctgctaaagttccaaaaggtaatccttaccatagtgctacttcaggagagatggca
atttacagggcaaacagccttattttaagaaaggctggtgcacagatagctgaccctgta
attgatactttcaatggccaagaggtagaggtttggccacgcataacctggatcccaagg
tggggtcttatattcaaggatgtcaaagccaaagtccatagcaactcttcagtttctcag
aggtcagccttggtcatcaatggcaagaacatcaccattcaaggcctctccttggatggc
actcttatcgtaaatgccaaagatgaagccaagttcaatgttacaggtcatatagagaat
aaaggctggactatccagcacgtcgatcacaaggacacctcggagaaggaagagatcaga
atccgcgggttcaagttcaacaaggttgaacagctagagttgaactactag

DBGET integrated database retrieval system