KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343714
Entry
4343714           CDS       T01015                                 
Name
(RefSeq) 5-formyltetrahydrofolate cyclo-ligase, mitochondrial
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4343714
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     4343714
SSDB
Motif
Pfam: 5-FTHF_cyc-lig KTI12
Other DBs
NCBI-GeneID: 4343714
NCBI-ProteinID: XP_015645077
UniProt: Q0D564 A0A0N7KNR0
LinkDB
Position
7:23418996..23422452
AA seq 282 aa
MIKNGAASLMVRLLHLPRAASAPTYPRRRHHLALLPSLRLRVPAPAAAAAMSSAAAAQEV
ADQKRALRSEVRRALRALTPEQRASEDQAIQNAILNSSWFKESKRLCAYISCAQLREVDT
SKVLSEVLSPNSEHGHAKDLYVPRVEDKNRNMRMLKITTMDDLVKNSMNILEPSPLDASG
NAREEVLSTSSPVDLFLLPGQAFDRTGRRLGRGGGYYDTFLMRYQELAKEKGWDQPLLVA
LSYSVQILEEGIIPVNSTDVPIDALVSSSGIIPISPAALARI
NT seq 849 nt   +upstreamnt  +downstreamnt
atgattaaaaatggcgcggcctcgctgatggtgcgcctcctccacctgccccgcgccgca
tccgcccccacctacccccgccgccgccaccaccttgccctcctcccctcgctccggcta
cgagtgccggcgcccgccgccgccgccgccatgtcgagtgccgcggcggcgcaggaggtc
gccgaccagaagcgcgcgctgcggtccgaggtgcggagggcgctcagggccctcaccccc
gagcagcgcgccagcgaagaccaggctattcaaaatgcaattttgaactcttcttggttc
aaagaaagcaagcggttatgtgcttatataagctgtgcacaattgcgggaagttgataca
tcaaaagtactgtcagaagttttatccccaaattctgaacatggacatgcaaaggatctt
tatgttcctcgagtggaagataagaatcgcaatatgcggatgctcaaaatcactaccatg
gatgatttagttaaaaattcaatgaacattctagaaccatcaccacttgatgctagtggg
aatgctcgtgaagaagtgttgtcaacctcttcccctgttgatctttttctattgcctgga
caagcttttgataggactggacgaagattaggacgtggtggagggtactatgacacattc
ttgatgagatatcaagaacttgctaaagagaaagggtgggatcagcctcttctagtcgcg
ctttcatactcggtgcaaattttggaggaaggcatcatcccagtcaactcaacagatgtt
cctattgatgctctggtctcatcctctggcatcattccaatcagtcctgcagcattggcg
aggatataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351605
Entry
4351605           CDS       T01015                                 
Name
(RefSeq) 5-formyltetrahydrofolate cyclo-ligase-like protein COG0212
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4351605
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     4351605
SSDB
Motif
Pfam: 5-FTHF_cyc-lig
Other DBs
NCBI-GeneID: 4351605
NCBI-ProteinID: XP_015619854
UniProt: Q2QX67 Q0IPU5
LinkDB
Position
12:3431909..3437754
AA seq 350 aa
MPLLPASPPPLSLSRSLAAAAAASRRGRAVTCAAARGAASSSSASFDAAGFEAERLRLDA
EARAGMASAAAVAGAEAADPKAWKWAIRKRVWDALEAEGVARDPRPVHHRIPNFDGAAAA
ADSLGRLDVFQDAQCVKVNPDSPQKQVRFLTLSGDKKLLTPQPRLRTGFFSVLESHMIPI
GCIPEACTSVGAAKYGRPIGLDEKIKVDLIVIGSVAVDPSTGARLGKGEGFAELEYGMLR
YMGSISDSTMIVTTVHDKQLVNDIPVEKLLVHDVPVDIICTPTQVIFTNTTIAKPQGIYW
EKLSPEKLGQIRILQELKRRIESETGTTLPCGPSEKLPPTAQRRRRKRRR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcctctcctgccggcgtcgccgccgccgctgtcgctgtctcggtcgttggctgcggcg
gcggcagcctctcgtcgcggccgcgccgtgacgtgcgcagctgcgaggggcgcggcttcg
tcttcgtcggcctcgttcgacgcggcggggttcgaggccgagcggctccgcctcgacgca
gaggcgcgggccgggatggcgtccgcggcggcggtggcgggggcggaggcggcggacccc
aaggcgtggaagtgggcgatacggaagcgggtgtgggacgcgctggaggcggagggcgtc
gcgcgcgacccgcgccccgtccaccaccgcatccccaacttcgatggcgccgcagccgcc
gcggactcgctggggagactcgacgtgttccaggatgcacaatgtgtgaaggtcaatccc
gactcacctcagaagcaagttcgcttcttaacactctcaggagataaaaagttgctgact
ccgcaacctcggctaaggacaggatttttctcagttctggaatctcacatgatacccatt
ggatgtattccagaagcatgtacttctgttggtgcagccaaatacgggagacctataggt
ctagatgaaaaaattaaagtggatttgattgtgattggatcggttgcagttgatccaagc
acaggagcacgactaggaaagggcgagggatttgcagagctggaatatgggatgctgcgt
tatatgggatctataagcgattcaaccatgatagtaacaactgtgcatgacaaacaatta
gtgaatgacattccagttgagaagctgttagttcatgatgtaccagttgacattatctgc
actccaactcaggtcatattcacaaataccacgatcgcgaaaccacaagggatttactgg
gaaaagttatctccagagaaattgggccaaatccgaattctacaggagctgaagagacgc
atagagagtgaaacaggaactacacttccttgtggcccttctgagaagctaccaccaaca
gcgcagcgaagaagaagaaaacgaagacggtga

DBGET integrated database retrieval system