KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345281
Entry
4345281           CDS       T01015                                 
Name
(RefSeq) GMP synthase [glutamine-hydrolyzing]
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Module
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4345281
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4345281
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     4345281
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   4345281
SSDB
Motif
Pfam: GMP_synt_C GATase Peptidase_C26 NAD_synthase tRNA_Me_trans ThiI QueC GATase_5 PAPS_reduct
Other DBs
NCBI-GeneID: 4345281
NCBI-ProteinID: XP_015650774
UniProt: A0A0P0XEC6 Q8H4X9
LinkDB
Position
8:14356976..14360827
AA seq 544 aa
MGSASASSLPASAGFGENLVLILDFGSQYTHLITRRVRQLGVLSLCVSGTAPLASLAGLR
PRAVVLSGGPHSVHASGAPTFPEGFLEFAAGAGAHVLGVCYGMQLLVQSLGGAVEAGEKQ
EYGKMEVEVTARSSALYGEGEVGKRQTVWMSHGDEVVRLPEGFEVVARSVQGAVAAVENR
EKRFYGLQYHPEVTHSPQGMETLRRFLFDVCGIKADWKMQDVLDEEIRTIQSMVGPDEHV
ICALSGGVDSTVAATLVHKAIGDRLHCVFVDNGLLRYNERERVMLTFESDLHLPVTCVDA
SEQFLSKLKGVKDPEMKRKIIGREFIAVFDDFAHKLEQKIGKRPGYLVQGTLYPDVIESC
PPPGSGRTHSHTIKSHHNVGGLPKDMKLKLIEPLKLLFKDEVRKLGSILNVPESFLKRHP
FPGPGLAVRVLGDVTEGNALEVLRQVDEIFVQAIKDAGLYDIIWQAFAVFLPVQTVGVQG
DQRTHSNAVALRAITSEDGMTADWYYFEREFLVDVVNKICNNVRGVNRVVQDITQKPPAT
VEWE
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgggctccgcctccgcttcctcgctcccggcctccgccggcttcggcgagaacctggtc
ctcatcctcgacttcggctcgcagtacacccacctcatcacccgccgcgtccgccagctg
ggggtcctctccctctgcgtctccggcacggcgccgctcgcctcgctcgcgggcctccgc
ccccgcgccgtcgtcctctccggggggccccactccgtacacgcctcgggggcgcccacg
ttccccgaggggttcctcgagttcgccgccggcgcgggcgcccacgtcctcggcgtctgc
tacgggatgcagctcctcgtgcagtccctcggcggcgccgtcgaggccggcgagaagcag
gagtacgggaagatggaggtggaggtaaccgcccgctcctcggcgctgtacggggagggg
gaggtcgggaagcgccagacggtgtggatgagccacggggatgaggtggtgaggctgccg
gaggggttcgaggtggtggcgcgcagcgtgcagggtgccgtcgctgccgtcgagaaccgt
gagaagcgcttctatgggcttcagtatcaccctgaggtgacacattcaccccaaggaatg
gaaacactgcggcgcttcctttttgatgtttgtgggataaaagctgattggaagatgcaa
gatgtgctggatgaagaaattaggacaatccaaagcatggttgggcctgatgaacatgtg
atttgtgctttatctggtggagttgattcaactgttgctgccactctggttcacaaggca
ataggggatagacttcactgtgtttttgttgacaatggcctattaagatacaatgagagg
gaacgggtaatgttaacctttgaaagtgacttgcaccttcccgtcacatgtgttgatgca
tctgagcaatttcttagcaagctaaagggtgtcaaagatccagaaatgaagagaaagata
attggaagggaattcatagcagtttttgatgattttgctcacaaattagaacagaagata
ggaaaaagacctggatatttagttcaagggacactgtaccctgatgtgattgaatcatgc
ccacctcctggaagcggaaggacacattctcataccatcaaaagccatcacaatgttggt
ggtcttccaaaagatatgaagttaaagctaattgaaccactcaagctcttatttaaggat
gaggtacggaagttggggagtattttaaatgtcccagagtcattcttgaagcgacaccca
tttcctgggcctggtcttgctgtacgtgtcctaggtgatgttacagaaggcaatgctttg
gaggttcttcgtcaggttgatgaaatatttgttcaagccattaaagatgcaggtctctat
gatataatttggcaagcatttgctgtgtttttgcctgtacaaacagtgggagttcagggt
gaccagagaactcactccaatgcagttgctttgagggcaattactagtgaggatggcatg
actgcagattggtattattttgagcgtgagttcctggtagatgtggtcaacaagatctgc
aacaatgtgcgaggtgttaaccgtgttgtccaggacatcacgcaaaagccacctgcgaca
gtggaatgggaatag

DBGET integrated database retrieval system