KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345809
Entry
4345809           CDS       T01015                                 
Name
(RefSeq) glycoprotein 3-alpha-L-fucosyltransferase A
  KO
K00753  glycoprotein 3-alpha-L-fucosyltransferase [EC:2.4.1.214]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4345809
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4345809
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.214  glycoprotein 3-alpha-L-fucosyltransferase
     4345809
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4345809
SSDB
Motif
Pfam: Glyco_transf_10 Exostosin DUF2452
Other DBs
NCBI-GeneID: 4345809
NCBI-ProteinID: XP_015650720
UniProt: Q0J531 Q6ZDE5
LinkDB
Position
8:23273325..23281518
AA seq 513 aa
MKGSHSQSQAQAQSQAGRRRRCGWLLPLLVGAAFLAEIAFLGRLDMAKNAAAVESWTTSF
YARSSAPARDGKAAVVVPGADADDAPPGGGEVVEEDDGDIRLCEERLEREDGVPHDRDFD
KDPVLVGGAAKDWNKCSVGCEFGFSATKTPDATFGIAPDPTVESILRSMESSQYYSENNI
AVARGRGYKIVMTTSLSSDVPVGYFSWAEYDIMAPVPPKTEEALAAAFISNCGARNFRLQ
ALEMLESLDVKIDSYGSCHRNHDGKVDKVETLKRYKFSLAFENSNEEDYVTEKFFQSLVT
GAIPVVIGAPNIQEFSPGEGAILHIKELDDVPSIAKTMKHIASNQEAFNQSLRWKYDGPS
DSFKALIDMAAVHSSCRLCIHVATKIHEKEERTPKFMNRPCSCSSKRGKVYHLFVRERGR
FKTESIFLRSDQLTMGALESAVLAKFRSLNHVPVWKDERPPSIRGGDELKVYKIYPIGLT
QRQALYQFRFRDDADLDKYIKDHPCAKLEVIFV
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaaggggtcccactcgcagtcgcaggcccaggcccagtcccaggcgggccggcggcgg
cggtgcgggtggctgctgccgctcctcgtcggcgcggccttcctcgccgagatcgcgttc
ctcggccgcctcgacatggcgaagaacgccgccgcggtcgagagctggaccacctccttc
tacgcccgctcctccgcccccgcccgcgacgggaaggcagcggtcgtggtccccggcgcg
gacgcggacgacgcgcccccgggcggaggtgaggtggtggaggaggacgacggcgacatc
cggttgtgcgaggagcggcttgagagggaggacggcgtgccgcacgaccgcgacttcgac
aaggatcccgtcctcgtcgggggcgccgctaaggattggaataaatgttctgtaggatgt
gaatttgggttttcagctactaagacgcctgatgctacttttggaattgccccagatcct
actgtagagagtatcctcagatcgatggagtcatctcagtattattcagagaacaacatt
gctgtggctcgagggagaggttacaaaattgtgatgacaacaagcctttcctcagatgta
cctgttggctacttttcatgggctgaatatgatataatggcacctgtgcctccaaaaact
gaagaagccctagctgcagcatttatttcaaactgtggtgcacgtaattttcgtttgcaa
gcccttgagatgcttgagagcttagatgtcaaaattgattcatatggtagttgccatcgt
aatcatgatggcaaagttgataaagtggaaactttgaagcgctacaaatttagcttggcc
tttgagaattccaacgaggaagattatgttacagaaaagttttttcaatcgctggtaaca
ggagctattccagttgtgattggtgctccaaacattcaagagttctctcctggagaaggc
gcaatattacacattaaagagcttgatgatgttccttcaattgccaagacaatgaaacat
attgcatcaaatcaggaagcctttaatcaatctttgagatggaagtatgatggcccatct
gattctttcaaggcccttattgacatggcagcggttcattcatcatgtcgtctttgcata
catgtcgcgacgaagattcatgagaaagaggaaaggacaccaaaatttatgaatcgccca
tgtagttgttcaagcaaaagaggaaaggtataccacttgtttgtcagagaaagagggcgg
ttcaagacagagagcatttttctgaggtcggaccaattaactatgggtgctttggagtct
gctgtgcttgctaaatttagatcgctcaatcatgttcctgtgtggaaggatgaaagacca
ccaagtattagaggtggggacgagttgaaggtatacaaaatttatccaatcggccttaca
caacgacaggcattataccagttcagatttagagatgacgcagatcttgacaaatacatt
aaagatcatccatgtgcaaagcttgaagtgatttttgtataa

DBGET integrated database retrieval system