KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345969
Entry
4345969           CDS       T01015                                 
Name
(RefSeq) beta-(1,2)-xylosyltransferase
  KO
K03714  glycoprotein 2-beta-D-xylosyltransferase [EC:2.4.2.38]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4345969
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4345969
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.38  glycoprotein 2-beta-D-xylosyltransferase
     4345969
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4345969
SSDB
Motif
Pfam: Glyco_transf_61
Other DBs
NCBI-GeneID: 4345969
NCBI-ProteinID: XP_015650207
LinkDB
Position
8:24887575..24891938
AA seq 620 aa
MNLSRPIWWAHTSPDFVQFGVATLTCGPHFYYGPHVSDTTASCTRVRRSRLREFARDRFR
DPFNPDLRRREPRRRRRRRAPRRRRKAMMPVRTYHHHHHHNNSNNHRLRRIIPRVLLAVF
AIYAVSFAAYLLRHQSPHPHPHPAADPERDAVDAAGGGGGGGAVDRVRVEAPSSQKPWPR
LPSFLPWTSASVRPPPKHSCEGYFGNGFSRLVDVLPARGGGGGGWFRCHHSETLRSSICE
GGRVRLDPGLIAMSRGGEPLDQVMGRAEEEELPKYEPGALQVEAAAKRTGPLVEAGFLDA
YVPTGGIGMHTMRSLLDSGRVVPPGELHCSQWVEEPTLLVTRFEYANLFHTITDWYSAYV
SSRVTDLPNRPNVVFVDGHCKAQLEQTWEALFSNVTYVKNFSGPVCFRHAILSPLGYETA
LFKGLSESFSCEGASAESLREKPDHQKTARLSEFGEMILASFDLLRDDILSSKTSNGLNV
LFVRREDYLAHPRHSGKVESRLSNEKEVYDAIEGWAKGQKCKINVINGLFAHMNMKEQLR
AIQEASVVIGAHGAGLTHLVSATPDTKVLEIISSMYRRPHFALISHWKSLEYHAINLPGS
YARVTDVINELSNILKGFGC
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaatctcagccgtccgatctggtgggcccacacttcccccgactttgttcagtttgga
gttgcgacactgacatgtgggccccacttttactatggcccacacgtcagtgacacaacg
gcaagctgcacaagggtcaggcgatctcgtctccgcgagttcgctcgcgaccgcttccga
gatccgttcaaccccgatctacgccgccgagaacctcgccggcggcgacgacgacgagca
cctcgccggcggcggaaggcgatgatgcctgtacgcacgtaccaccaccaccaccaccac
aacaacagcaacaaccatcggctacgccgcatcatcccccgagtcctcctcgccgtcttc
gccatctacgccgtctcgttcgcggcgtacctcctccgccaccagtcgccgcacccgcac
ccgcaccctgccgctgaccccgagcgcgacgccgtggacgcagccggaggaggcggagga
ggaggagccgtggaccgtgtgcgggtagaagcgccgtcctcgcagaagccatggcctcgc
ctcccctccttcctcccgtggacgtccgcctccgttcggccgccgccgaagcactcctgt
gaggggtacttcgggaacgggttctcccgcctcgtggacgtgctccccgcgcggggcggc
ggcggcggcgggtggttccggtgccaccacagcgagacgctgcgcagctcgatctgcgag
ggcgggagggtgcggctcgacccggggctcatcgcgatgtcgcgcggcggcgagccgctc
gaccaggtgatgggccgcgccgaggaggaggagctgcccaagtacgagcccggcgcgctg
caggtggaggcggcggcgaagaggacggggccgttggtggaagcggggttcctcgacgcc
tacgtgcccaccggcgggatcgggatgcacacgatgaggtcgctgctcgactcggggcgc
gtcgtgccgcccggcgagctacactgctcgcagtgggttgaagaaccaacacttctagta
actcgttttgaatatgcaaaccttttccacacaattacggactggtacagtgcatatgtc
agttccagagtcacggatttacctaaccgccctaatgtggtctttgtggatggacattgc
aaggcacaactggagcaaacatgggaagcacttttctcaaatgtgacatatgttaagaat
ttctctggccctgtttgttttcgacatgcaattctttcaccattgggctatgagactgcg
ctatttaagggccttagtgagagctttagctgcgaaggtgcttctgcggagtccctcaga
gaaaagcctgatcaccagaaaacggcaaggttgtctgaatttggtgagatgattttagct
tcttttgatcttctgagggatgacatactgtcatccaaaacatcaaatgggctcaatgtt
ctctttgttcggcgagaggactacttggcccatccacgccacagtggaaaggttgaatct
agactaagcaatgagaaggaggtatatgatgcaattgagggctgggcaaaaggtcagaaa
tgcaaaataaatgtcatcaatggtctttttgcccacatgaacatgaaggagcaactgcgt
gctatacaggaagcttcagtagtaataggggcacatggggctggtctaactcacttggtt
tcagctaccccagatacaaaagtccttgaaatcatcagcagcatgtatcgacgcccacat
tttgcattgatctcacactggaagagcttagagtatcatgccataaatctccctggatca
tatgcaagggtaacagatgttatcaatgagttgagtaatatactgaaaggttttggatgc
tga

DBGET integrated database retrieval system