KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347190
Entry
4347190           CDS       T01015                                 
Name
(RefSeq) phospholipid:diacylglycerol acyltransferase 1
  KO
K00679  phospholipid:diacylglycerol acyltransferase [EC:2.3.1.158]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4347190
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.158  phospholipid:diacylglycerol acyltransferase
     4347190
SSDB
Motif
Pfam: LCAT
Other DBs
NCBI-GeneID: 4347190
NCBI-ProteinID: XP_015612493
UniProt: A0A0P0XNR9 Q67U60
LinkDB
Position
9:complement(16543033..16549779)
AA seq 691 aa
MSLLRRRKQPQPPPEQPNEDSSNGSDLDEKGKKKPGSSSSSAAPPPEAAAAAAKEATKRT
RARWSCVDSCCWLVGCVCSAWWLLLFLYNAMPASFPQYVTEAITGPLPDPPGVKLQKEGL
RAKHPVVFVPGIVTGGLELWEGHQCAEGLFRKRLWGGTFGDVYKRPLCWVEHMSLDNETG
LDKPGIRVRPVTGLVAADYFVPGYFVWAVLIANLARIGYEEKTMYMAAYDWRLSFQNTEV
RDQTLSRIKSNIELLVATNGGNRVVVIPHSMGVLYFLHFMKWVEAPPPMGGGGGPNWCAK
HIKSVMNIGGPFLGVPKAVAGLFSSEAKDVAVARAIAPEVLDSDFLGLQTLRHLMRMTRT
WDSTMSMIPKGGDTIWGDLDWSPEDGFECKAKNQKINDSEVSKDANGKNEVHPEPVKYGR
IVSFGKDVAEAPSSEIEQIEFRDAVKGNNIAHSNTSCRDIWTEYHELGWGGIKAVADYKV
YTAGSIIDLLRFVAPRMMQRGSVHFSYGIADNLDDPKYGHYKYWSNPLETKLPNAPEMEI
FSMYGVGIPTERAYVYKLAPQAECYIPFQIDASAEGGDENSCLKGGVYLSNGDETVPVLS
AGYMCAKGWRGKTRFNPSGSKTYVREYSHSPPSNLLEGRGTQSGAHVDIMGNFALIEDII
RIAAGATGEELGGDQVYSDIFKWSDKIKLKL
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgtcgctgctgcggcgccggaagcagccgcagccgccgccggagcagccgaacgaggac
agcagcaacggctccgacctcgacgagaaggggaagaagaagccgggatcgtcgtcctcc
tcggcggcgcctcctccggaggcggcggcggcggcggcgaaggaggcgacgaagcggacg
agggccaggtggtcgtgcgtggacagctgctgctggctggtggggtgcgtgtgctcggcg
tggtggctgctgctcttcctgtacaacgcgatgccggcgtcgttcccgcagtacgtcacg
gaggcgatcacggggccgctcccggaccctcccggggtcaagctgcagaaggaggggctg
cgggcgaagcaccccgtcgtgttcgtcccgggcatcgtcaccggcggcctcgagctctgg
gaggggcaccagtgcgccgaggggctcttccgcaagcgcctctggggcggcacgttcggc
gacgtgtacaagaggcctttatgctgggttgaacatatgtcactggacaatgaaactgga
ttagataaaccaggaataagagttcggccagtcacaggcctagtggcagcagactatttt
gttcctgggtattttgtttgggctgttttgattgcaaatttagctcgtattggatatgaa
gaaaagaccatgtacatggctgcatatgattggaggttatctttccagaacactgaggtt
cgtgatcaaactttgagcaggataaaaagtaacattgaactcctggtagcaactaatggt
ggaaatagggtggtggtgatcccacattctatgggggttctctattttctgcattttatg
aagtgggttgaggctcctcctcccatgggtggtggtggtggtccaaattggtgtgcaaag
cacatcaaatctgtaatgaatattggcggacctttcttaggagttcctaaggctgttgca
ggacttttctcatctgaagccaaagatgttgctgttgctagagccattgcaccagaagtc
ctagactctgacttccttggacttcagaccttacgccatttgatgcgtatgacccgcaca
tgggattcaacaatgtcaatgattcctaagggcggtgacaccatttggggagatttggat
tggtctccagaagatggttttgagtgtaaagctaagaatcagaaaatcaatgattctgag
gtttctaaggatgctaacgggaagaatgaggttcatccagaacctgttaagtatggaaga
attgtctctttcggtaaagatgtagcagaggctccatcttcagaaattgagcagatagaa
tttcgtgatgctgtcaaaggcaataatattgcccactcaaatacatcatgccgggatata
tggacagagtatcatgaattaggatggggcggaataaaggcagttgcagactacaaggtt
tacactgctggctccattatagatcttcttcgttttgttgctccaaggatgatgcagcgt
ggaagtgttcacttttcgtatgggattgctgacaacttggatgatccaaagtacggccac
tacaaatactggtcaaatcccttggaaacaaaattaccaaatgcacctgaaatggaaata
ttttcaatgtatggagttggcattccgacggagagagcatatgtctataaattagcccca
caagcagagtgctatataccttttcagatagacgcttcagctgagggtggggatgagaat
agctgtctgaaaggcggcgtttacctgtctaatggtgatgagaccgtaccagttcttagt
gcaggatatatgtgcgcaaaaggctggcgaggaaaaacacgcttcaacccttctggcagc
aagacctacgtcagagaatacagccattctccaccctcaaatctcctcgaaggcaggggc
acccagagtggtgcgcacgttgatatcatggggaattttgctttaatcgaggatattatc
aggattgctgctggggcaactggtgaagagcttggcggtgaccaggtttattccgatata
ttcaaatggtctgataagattaaattgaaactataa

DBGET integrated database retrieval system