KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348803
Entry
4348803           CDS       T01015                                 
Name
(RefSeq) inosine triphosphate pyrophosphatase
  KO
K01519  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4348803
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     4348803
SSDB
Motif
Pfam: Ham1p_like
Other DBs
NCBI-GeneID: 4348803
NCBI-ProteinID: XP_015613001
UniProt: Q7XDP2
LinkDB
Position
10:complement(16769054..16771735)
AA seq 205 aa
MSGAAAAAARALPKAVTFVTGNAKKLEEVRAILGSSIPFQSLKLDLPELQGEPEDISKEK
ARMAASQVNGPVLVEDTCLCFNALKGLPGPYIKWFLEKTGHEGLNNLLLAYEDKSAFAMC
IFSLALGPGEEPMTFVGKTAGKIVPARGPADFGWDPVFQPDGFDQTYAEMPKSVKNQISH
RGKALALVKEHFAAANYKVQNDGSA
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtccggggcggcggcggcggcggcgcgggcgctgcccaaggcggtgaccttcgtgacg
ggcaacgccaagaagctggaggaagtccgcgccatcctcggctcctccatccccttccag
tccctcaagctcgacctccctgaattgcaaggtgagccggaggacatatctaaagagaaa
gcacgaatggctgcatcccaggtgaatgggcctgtacttgttgaggacacctgcctatgc
ttcaatgcactcaaaggcttaccagggccctacataaaatggttccttgagaaaactggg
catgaaggtttgaacaatttgttgctagcctatgaagataaatctgcttttgctatgtgc
atcttttctcttgctcttggaccaggagaagaaccaatgacattcgttgggaaaacagca
ggaaagattgtgcctgctagaggacctgctgattttggatgggacccagtattccaacca
gatggttttgatcaaacctacgctgagatgcccaagtcagtgaagaatcaaatatctcac
aggggaaaagctcttgctttggtgaaagaacactttgcagctgccaactataaagttcag
aacgatggttcagcttga

DBGET integrated database retrieval system