KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351945
Entry
4351945           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 71A1
  KO
K24541  tryptamine 5-hydroxylase [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00936  Melatonin biosynthesis, plants, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    4351945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4351945
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     4351945
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP71 family
   4351945
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4351945
NCBI-ProteinID: XP_015618264
UniProt: Q2QUC5
LinkDB
Position
12:complement(9579767..9582009)
AA seq 523 aa
MELTMASTMSLALLVLSAAYVLVALRRSRSSSSKPRRLPPSPPGWPVIGHLHLMSGMPHH
ALAELARTMRAPLFRMRLGSVPAVVISKPDLARAALTTNDAALASRPHLLSGQFLSFGCS
DVTFAPAGPYHRMARRVVVSELLSARRVATYGAVRVKELRRLLAHLTKNTSPAKPVDLSE
CFLNLANDVLCRVAFGRRFPHGEGDKLGAVLAEAQDLFAGFTIGDFFPELEPVASTVTGL
RRRLKKCLADLREACDVIVDEHISGNRQRIPGDRDEDFVDVLLRVQKSPDLEVPLTDDNL
KALVLDMFVAGTDTTFATLEWVMTELVRHPRILKKAQEEVRRVVGDSGRVEESHLGELHY
MRAIIKETFRLHPAVPLLVPRESVAPCTLGGYDIPARTRVFINTFAMGRDPEIWDNPLEY
SPERFESAGGGGEIDLKDPDYKLLPFGGGRRGCPGYTFALATVQVSLASLLYHFEWALPA
GVRAEDVNLDETFGLATRKKEPLFVAVRKSDAYEFKGEELSEV
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggagctcaccatggcgtcgacgatgtcgctcgcgctgctcgtgctctccgcggcgtac
gtgttggtcgcgttgaggaggagccggtcgtcgtcgtcaaagccacggcggctgccgccg
tcgccgccggggtggccggtgatcgggcacctccacctcatgtccggcatgccgcaccac
gcgctggccgagctggcgcgcaccatgcgcgcgccgctgttccggatgcggctggggagc
gtgccggcggtggtgatctccaagccggacctcgcccgcgccgcgctcaccaccaacgac
gccgcgctggcgtcgcggccgcacctgctctccggccagttcctgtcgttcggctgctcc
gacgtgacgttcgcgccggcggggccgtaccaccggatggcgcgccgcgtggtggtgtcg
gagctcctgtcggcgcgtcgcgtcgccacgtacggcgccgtcagggtcaaggagctccgc
cgcctgctcgcgcacctcaccaagaacacctcgccggcgaagcccgtcgacctcagcgag
tgcttcctcaacctcgccaacgacgtgctctgccgcgtcgcgttcggccgccggttcccg
cacggcgagggcgacaagctcggcgcggtgctcgccgaggcgcaggacctcttcgccggg
ttcaccatcggcgacttcttccccgagctcgagcccgtcgccagcaccgtcaccggactc
cgccgccgcctcaagaagtgcctcgccgacctccgcgaggcctgcgacgtgatcgtggac
gaacacatcagcggcaaccgccagcgcatccccggcgaccgcgacgaggacttcgtcgac
gtcctcctccgcgtccagaaatcccccgacctcgaggtccccctaaccgacgacaatctc
aaggccctcgtcctggacatgttcgtcgccggcacggacaccacgttcgcgacgctggag
tgggtgatgacggagctagtccgccacccacggatcctcaagaaggcgcaggaggaggtc
cggcgagtcgtcggcgacagcggccgcgtcgaggagtcccacctcggcgagctccactac
atgcgcgccatcatcaaggagacgttccggctgcacccggcggtgccgttgctagtgccg
cgcgagtccgtcgcgccgtgcacgctgggcggctacgacatcccggcgaggacgcgggtg
ttcatcaacacgttcgccatggggcgcgacccggagatctgggacaacccgctggagtac
tcgccggagaggttcgagagcgccggcggcggcggcgagatcgacctcaaggacccggac
tacaagctgctgccgttcggcggcgggcggcgagggtgccccggctacacgttcgcgctc
gccaccgtgcaggtgtcgctcgccagcttgctctaccacttcgagtgggcgctgcccgcc
ggcgtgcgcgccgaggacgtcaacctcgacgagacgttcggcctcgccacgaggaagaag
gagccgctcttcgtcgccgtcaggaagagcgacgcgtacgagtttaagggagaggagctt
agtgaggtttaa

DBGET integrated database retrieval system