KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352052
Entry
4352052           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4352052
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4352052
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4352052
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     4352052
    3.1.3.48  protein-tyrosine-phosphatase
     4352052
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     4352052
Protein phosphatases and associated proteins [BR:osa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    4352052
SSDB
Motif
Pfam: Y_phosphatase3 DSPc Y_phosphatase
Other DBs
NCBI-GeneID: 4352052
NCBI-ProteinID: XP_015619810
UniProt: Q2QT46 Q0INR2
LinkDB
Position
12:complement(12321660..12330180)
AA seq 658 aa
MEEQQVKPSDSHPPPATPVDSQDSTAPPVRTPDPVSQATSNDSATQFASTVHVAPSPAPV
PNAVPIQDAAGREAQSSIFSTSGLSSWAKNLKIPQPSSGQESPTGKNTFSRLTSGLGLRL
SPKGPQQDESAEGSTTPTTAQSGVFGSFTKGIVDSSKNAVKAVQVKARHMVSQNKRRYQE
GGFDLDMTYITENIIAMGFPAGDLSSGLFGYFEGFYRNHMEEVIRFFEMHHKGKYKVYNL
CSERLYDASLFEGKVACFPFDDHNCPPIQLVISFCHSAYSWLKEDIENVVVVHCKAGKAR
TGLMISSLLLYLKFFPTAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFNGENQ
PPRRCMLRGFRLHRCPYWIRPSITVSNHNGVLFTTKKHPRTKELMPEDFWFSAPKKGIMV
FALPGEPGLTEVAGDFKIQFHDRQGDFYCWLNTTMMENRVTLNPTDLDDFDKRKLPSPGF
QVEVVLVDYDGSQPPKPKPAAASTDQKSEADSSTGTVAKGNNASSAEVSNKESARNDKDD
VFSDSEAEDGSSKGRREKVSRNVEGTTNAAKASETSSVQKEASAAASRIEKVSITSEQGS
ARTPDAAPLKSGVSSKSSSTTAPPPPPAAADSSMSEFKAIAADASVFSFGDEDDYESE
NT seq 1977 nt   +upstreamnt  +downstreamnt
atggaagaacagcaagtaaagccctctgattcacatccaccacctgctactccggtggac
agccaggattcaactgcacctcctgtcagaactcctgaccctgtttctcaggctacttca
aatgattctgccacccagtttgccagtacagtccatgtagccccttcacctgcacctgtt
ccaaatgctgttccaatacaagatgctgcaggacgcgaggcacaatcctccatattttca
acatctggcttatcctcctgggcaaaaaacctgaaaataccacagccttcttcaggtcaa
gaatcaccaacggggaagaacacattttctcgcctcacgagtggccttgggttgcgcttg
tctccaaaaggtcctcagcaagatgagagtgctgaaggcagcacaaccccaacaacagca
caatctggcgtttttggctcttttactaaaggcatcgtggattcctctaagaatgctgtt
aaggcagtgcaagtcaaggctcgccacatggtctcacagaataaaagacgatatcaggaa
ggcggctttgatttagatatgacatatattacagagaacatcattgctatgggtttccct
gctggagatttgagctcagggctttttggatattttgagggcttctaccgcaaccacatg
gaggaagtcatcaggttctttgaaatgcaccacaagggaaagtataaggtgtacaacctt
tgctcggaaaggctatatgatgcatctctttttgagggaaaggttgcatgcttccctttt
gatgatcacaattgccctccgatacaacttgtcatatcgttctgccatagtgcttactct
tggttgaaggaagatatagaaaatgtagtggttgttcattgcaaagctggaaaggcgagg
acaggattgatgatctccagtctgctactatacctgaagttctttccaactgcggaagag
tccattgaatactacaatcagaaaagatgtgtagatggaaaagggcttattctcccaagt
cagattagatatgtgaaatattttgagcgcatcttaacttacttcaatggtgaaaatcag
cctccacgcaggtgcatgctcaggggatttcgccttcatagatgcccttattggattaga
ccatcaatcactgtgtctaatcacaatggtgttcttttcacaactaagaagcaccctaga
acaaaggagctgatgccagaagatttctggtttagtgcaccaaagaaagggatcatggtt
tttgcgttgcctggagagcctggattaacagaggtagctggtgacttcaagattcagttt
catgatcgacagggggatttctactgctggttaaatacaacaatgatggagaacagggtg
actttgaatccaactgatcttgatgattttgacaagaggaaattaccatcacctggattc
caggttgaggttgtcctggtagactatgatggttcacaaccaccaaaaccaaaaccagct
gccgcatctactgatcagaagtctgaagctgattcctcgactggaactgttgcaaaagga
aataatgcttcatctgcagaagtgtccaacaaggaatctgcaaggaatgataaggatgac
gtcttctctgacagtgaagcagaagatggatcatccaagggcagaagggagaaggtctct
aggaacgttgagggtactactaatgctgcaaaagcgtctgaaacaagctctgtgcaaaag
gaggcgtctgctgctgcttccagaattgaaaaagtatcaataaccagcgaacaaggaagt
gcaaggacacctgatgctgcacctctcaaaagtggagttagcagcaagagcagctccacc
acagcaccaccaccacccccagcggctgctgactccagcatgagcgagttcaaggcaatt
gctgcagacgcttcggtcttctcgttcggagatgaagacgactatgaaagcgaataa

DBGET integrated database retrieval system