KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352649
Entry
4352649           CDS       T01015                                 
Name
(RefSeq) GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
  KO
K03844  alpha-1,2-mannosyltransferase [EC:2.4.1.131]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4352649
   00513 Various types of N-glycan biosynthesis
    4352649
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4352649
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.131  GDP-Man:Man3GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     4352649
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4352649
SSDB
Motif
Pfam: ALG11_N Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2 Glyco_transf_4
Other DBs
NCBI-GeneID: 4352649
NCBI-ProteinID: XP_015618675
UniProt: Q2QN13
LinkDB
Position
12:complement(24204649..24208290)
AA seq 457 aa
MAFLAGLAALLAALLAAAFRRIRRHPHPAPAAGFFHPYTNDGGGGERVLWCAVRAAQELR
PGLPCAVFTGDADASPDGLAARALDRFGVRLLRPPQVVHLNRRKWIEASTYPHFTMIGQS
LGSVYLAWEALNKFTPQFYFDTSGYAFTYPLARLFGCKVICYTHYPTISSDMVERVKQRS
SMYNNDSRIAGSIWLSRCKILYYSIFSWLYGLVGSCAHLVMVNSSWTRSHIENIWRIPER
TRRVYPPCDTSALQMLPLERSTTPPILISVAQFRPEKAHGLQLEAFAIALKKLSPEFPKP
KLQFVGSCRNKEDLERLQKLKDRSTELHIDELVEFHKDISYRDLVQLLGGAVAGLHSMTD
EHFGISVVEYMAAGAIPIAHKSAGPMMDIVLDEDGQQTGFLASEKEEYAEAIVKVLRMPE
AERHEMATAARKRAQRFSEHRFHEDFTDAVRPILSAT
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggctttcctcgccggcctcgccgccctcctcgccgcgctcctcgccgccgccttccgc
cgcatccgccgccacccccaccccgcgcccgccgcggggttcttccacccgtacaccaac
gacggcggcggcggggagcgggtgctctggtgcgcggtgcgcgccgcgcaggagctccgc
ccgggcctcccctgcgccgtcttcaccggcgacgccgacgcctcccccgacggcctcgcc
gcccgcgcgctcgaccgcttcggggtccgcctcctccgcccgccgcaggttgttcacttg
aataggagaaagtggattgaagcaagcacgtatccccacttcacgatgattgggcaaagt
cttggctcagtttatcttgcatgggaagctcttaacaaattcaccccgcagttctatttt
gatacgagcggctatgcttttacatatccactggctcggctatttggctgtaaggtcatc
tgctacactcattatccgacaatcagttctgacatggttgaacgtgttaagcaacgcagt
tctatgtacaataacgactctcgtattgctggaagcatatggttgtcccgatgcaaaatc
ctctactatagcatattcagttggttatatggtctggtcggttcatgcgcacatcttgtg
atggtaaattcatcgtggacaagatcccatattgaaaatatttggaggataccagagcgt
actaggagggtataccctccatgtgatacttctgccctgcagatgcttccactggaaaga
tcaactacacctcctattcttatatcagttgcacagtttcggccagaaaaggcccatgga
cttcagcttgaggcatttgcaattgctcttaaaaagctaagtccagaatttcctaagcca
aagcttcaatttgttggaagctgtcggaataaagaggatctggaaagattgcaaaagctt
aaagacagatccactgaactacacatagatgagcttgtggagttccacaaggatatctct
tacagggacttggtacagcttctaggtggtgctgttgctgggctccattcaatgacagat
gagcattttgggataagtgttgttgaatacatggctgctggtgctattccaattgcccat
aaatcggcaggaccaatgatggacattgtgctagatgaggatggccaacagacaggattt
ctagcctccgagaaggaagaatatgccgaggcaattgtcaaggtcttgcggatgccggag
gcagagaggcatgagatggcaacagcagcacgaaaacgcgctcaaagattttctgagcat
aggttccatgaagatttcaccgatgcagttcgcccaattttgtcagcaacatga

DBGET integrated database retrieval system