KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268853
Entry
9268853           CDS       T01015                                 
Name
(RefSeq) CAAX prenyl protease 2
  KO
K08658  prenyl protein peptidase [EC:3.4.22.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    9268853
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    9268853
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-
     9268853
Peptidases and inhibitors [BR:osa01002]
 Glutamic peptidases
  Family G5: prenyl protease 2 family
   9268853
SSDB
Motif
Pfam: Rce1-like
Other DBs
NCBI-GeneID: 9268853
NCBI-ProteinID: XP_015637937
LinkDB
Position
5:16972938..16975975
AA seq 318 aa
MATPASFHHPASPQPAIPGAAAAAVAACAAMAVSYVAVLYAPTALLRLPPPTSLHVFLHR
RFLCAAFSSSASLLATASLLRVWSIGDSSVVLAVFGIRRDHLLQAVAIPLLLTSLVYAGS
FVARLWLLANSCGGGYEEPEIGWAQRLAHRIRASVGDVMVWRNCVVAPITEELVFRACMV
PLLLCGGFKIYNIIFLSPVFFSLAHLNHLFELHQQGRNFTRSLLIVGVQLGYTVIFGWYA
VFLFTRTGNIVSPIVAHIFCNIMGLPVFSSPQKRGVASVAFLAGSLSFFWLLFPATSPKL
YNSRIDQCSCWHGYCRWS
NT seq 957 nt   +upstreamnt  +downstreamnt
atggcgacgccggcgagcttccaccaccccgcctccccgcagccggcgatacccggcgcg
gcggcggcggcggtggccgcgtgcgccgccatggccgtctcctacgtcgcggtgctctac
gcccccacggccctcctccgcctcccgcccccgacctccctccacgtcttcctccaccgc
cgcttcctctgcgccgccttctcctcctcggcctccctcctcgccaccgcctccctcctc
cgcgtgtggagcatcggagattcgtccgtcgtgctcgccgtgtttggcattcggagagat
cacctgcttcaagcggtggcgattcccctcctccttacatcgctagtgtacgctggctcg
ttcgtcgcgaggctctggctgctggcgaattcgtgcggcggaggctatgaagagccggag
ataggctgggcacagaggcttgctcaccggatccgtgcctccgtaggagatgtgatggtt
tggcgcaactgcgtagtggcaccaattacagaggaattggttttccgggcgtgcatggta
cctcttcttctatgtggaggattcaaaatatataacattatatttctgagtccagtcttc
ttcagcctagcacacttgaaccatttattcgaactacatcaacagggacgcaattttacg
agatcactcctgatcgttggtgtccagttaggctacactgtaatttttgggtggtatgca
gtatttttgttcacccgaacagggaatatcgtctctcctattgttgcccacatattttgt
aacataatgggtttgccagttttctcatcaccacaaaaaagaggagtggcatcagtagca
tttctggctggttcattgtccttcttttggctccttttccctgcgacgagcccaaaacta
tataattctaggatagatcagtgcagttgttggcatggatattgcagatggagctaa

DBGET integrated database retrieval system