KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269006
Entry
9269006           CDS       T01015                                 
Name
(RefSeq) putative DNA ligase 4 isoform X1
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    9269006
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    9269006
Enzymes [BR:osa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     9269006
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     9269006
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C PTCB-BRCT BRCT RNA_ligase DNA_ligase_IV LIG3_BRCT mRNA_cap_enzyme
Other DBs
NCBI-GeneID: 9269006
NCBI-ProteinID: XP_015636869
LinkDB
Position
4:complement(30629646..30638863)
AA seq 1296 aa
MAATVRFGLLVAMFQAMSRDRTAAKKRARLRALLDRAYGPGGRDDYFSALRLVLPGLDRE
RGSYGLKEAALASVLVDALGIAKDSPDAVRLTNWRRGGGFRNAGNFALVAAEVLQRRQGM
TSGGLTIKEVNDALDRLAATENRSEKASILSSLIKKTNALEMKWLLMIILKDLKLGISEK
SVFHEFHPDAEDLFNVTCDLRLVCEKLNDRSQRHKRQDIEVGKAVRPQLSMRVNNASSAW
KKLHGKQVVAECKFDGDRIQIHKNGEEIHFFSRSFLDHSEYAPGMSKVIIENILVDRCIL
DGEMLVWDTVLNRFAEFGSNQEIAKAAKEGLETDRQLCYVAFDILYAGDTSVIHQSLTER
HEILQKVVRPLKGHLEILVPTGGLNIHRPPDEPCWSILAHSLDDVEKFFKDTVDNREEGI
ILKDLESKWEPGDRSGKWLKLKPDYIHAGADLDVIIIGGYYGSGRRGGEVAQFLVGLAVP
SDDNSYPKRFLSFCRVGTGLSDEELDALVTKLKPHFRKNEYPKKPPRFYEVTNHSKERPD
VWIESPDKSVIISITSDIRTIKSEVFAAPYSLRFPRIQRLRYDKPWHECLDVQAFVDIVH
SSNGTTHRAADDDNDLKNVKVKQPRTNKKGEKKNVSIIPSHLMKTDISGLKGETLIFANT
MFYFVNIPPSYNLDYFHKLVVENGGSFSMNLNDSVTHCIAAEKKGIKYQAATRQGRIIHY
SWILDCCKEKRLLHLQPKYILFLADFARHKFPEEIDSYADYFYWDIDISDLKQIFSNMDR
AVVDSNMVHHYKKKYCADERFCFFQGCCVYFYHAPLVNADYNVISDLALKRVKQDLTMHG
GQVCSILAPATHLIIVSVLQAYNFDMLYKSLPPAERRYLHDKRLQVVSNKWLEDSVEKQT
RLPETTYSLKPDTLEEIEIERSEETVQPCNDKLEENEKADTSHVKHAPRKRGRPSSSASR
TAKPAPRPVRRTRARRGNQHAKIDDVEPEESDHGETGLDDQIPDTDNISKMEVDSFDKDQ
VSARPVRRTRARRGKQHAKIDYGQSEESDPGETGQDDQRLDADYISKMEEDSSDRDQGAH
PTAPRVVRRSRAQRGKWLAKIDRETGPGETGQDDKKLNADSISKMEEHAHDKDQEPPPGA
QLITLDEQEPKGIKSSTTETPSSPKHERNQTVLRRDTAETTSSATCEKMEQMVDPLHAML
LDMIPSLGQMKTDVGNRVAEAKAETNPPWVGSSTSSYVAPVPQASASSASSSGVPAPHAG
SSTQSTGVPAPDPTAGAPKKKKVSYKDVAGALLKDW
NT seq 3891 nt   +upstreamnt  +downstreamnt
atggcggcgacggtgcggttcgggctgctggtggcgatgttccaggccatgtcgcgggac
cgcacggcggcgaagaagcgggcgcggctccgcgcgctcctcgaccgcgcctacgggccc
ggcggcagggacgactacttcagcgcgctccgcctcgtgctcccggggctcgaccgcgag
cgcggctcgtacgggctcaaggaggccgcgctcgcctccgtcctcgtcgacgccctcggg
atagccaaggactcgcccgacgccgtgcggctcaccaactggcggcgcgggggcggcttc
cgcaacgccggcaacttcgcactcgtcgccgctgaggtgctacagcggagacaaggaatg
acttctgggggattgacaataaaagaggtgaatgacgcacttgatcgcctggctgcaact
gagaataggtctgagaaggcttcgattctttctagtctgatcaagaaaaccaatgccctt
gaaatgaagtggctcttgatgattattctgaaagatttgaaattggggatcagtgagaag
agcgtatttcatgagttccatcctgatgctgaagacttgttcaatgtcacttgtgacctg
agattggtctgtgaaaagcttaatgatcgaagtcagaggcataagcgccaggatatagaa
gtggggaaggctgtcaggcctcagctatctatgagagtcaataatgcctcatctgcttgg
aagaagcttcacggaaaacaagtggttgctgagtgcaaatttgacggtgaccgtattcaa
attcacaagaatggggaagagattcatttcttctcaaggagctttcttgatcactcagaa
tatgcacctggaatgtccaaagttattatagaaaatatcttggttgacaggtgtattttg
gatggagaaatgcttgtttgggatactgtgcttaatcggtttgcagaatttggatcaaac
caggaaatagcaaaggccgcaaaggaggggctggagactgatcgacagttgtgctatgtt
gcttttgacattctttatgctggagacaccagtgttatccaccaaagtttgacagagcgg
catgaaattctgcagaaggttgtcagacctttgaagggccatctggaaatattagttcca
acaggtggcctgaacatccatcgtccgccagatgaaccatgctggtccattttggcacat
agtcttgatgatgtggagaaattcttcaaggacactgttgataatagagaagagggaatt
atactaaaggaccttgagtccaaatgggaacctggtgaccggagtggaaagtggcttaaa
ttaaagcctgattatatacatgctggtgctgatcttgatgttattattataggtgggtat
tatggctcaggacgtcgaggaggagaggttgcccagtttttagttggtcttgcagtgcct
tctgacgacaatagttatcccaaaagatttctttctttttgccgagtcggtactggtctt
tctgatgaagagcttgacgctcttgtcaccaaattgaagcctcatttcaggaaaaatgaa
taccccaaaaaaccaccaagattttatgaagtgacaaaccattcaaaggagaggccagat
gtttggatagaaagccctgataagtcagtcataatatccataacaagcgatattcgaaca
atcaaatctgaggtatttgctgccccatacagcttaaggttcccccgcattcaacggttg
agatacgataagccatggcacgagtgccttgatgttcaggcatttgtggacatcgtacat
tcaagtaatgggacaactcacagggcggcagatgatgataatgatctgaagaatgttaag
gtaaaacaaccgagaacaaacaaaaagggggagaaaaagaatgtgtcaatcatcccttca
catcttatgaagactgacatctcaggcctaaagggagaaacacttatatttgcaaataca
atgttttattttgtcaacatacctccatcatataatctcgactattttcataaactggtt
gtggagaatggcggatctttctcgatgaatcttaatgactcagttactcattgcatagca
gcggagaaaaaaggtatcaaatatcaggcagccacacggcagggaaggatcattcattat
tcctggatcttagactgttgcaaggaaaaacgccttcttcatttgcagcctaagtatatc
ctctttcttgcagattttgcaaggcacaaatttcctgaagagatcgactcatatgccgac
tatttctactgggacattgatatttctgacctcaagcagattttcagcaatatggacaga
gctgttgttgattcaaacatggtacaccactacaaaaagaagtattgcgcagatgagaga
ttctgcttcttccagggttgctgtgtctacttctatcatgcacccttggtgaatgcggac
tacaatgtaatatctgatcttgcactcaagagagtgaagcaggaccttaccatgcatggt
ggtcaagtgtgcagcattcttgctcccgctactcatttgattatagtttcagttctacaa
gcctacaattttgacatgctgtacaagagcctccctcctgccgagaggcgttatctacat
gacaaaagattgcaggttgtcagtaacaagtggttggaagattcagtggaaaaacaaaca
aggctgcctgaaaccacttacagccttaaaccggatacactagaagaaatagaaattgaa
cgaagtgaggaaactgttcagccttgtaatgacaagcttgaggaaaatgagaaggctgat
acatctcatgttaagcatgcaccaaggaaaaggggaaggccatccagtagtgcctcaaga
actgcaaagcctgctcctagaccagtccgaagaacaagagctagaagaggaaatcaacat
gcaaaaatagatgatgttgagcctgaagaaagtgaccatggtgaaacaggtctagatgat
caaataccagacacagataacatctctaaaatggaagtagatagctttgacaaagaccaa
gtttctgctagaccagtccgaagaacaagggctaggagaggaaaacagcatgccaaaatc
gattatggtcaatctgaagaaagtgatcctggtgaaacaggacaggatgatcaaaggttg
gatgcagattacatctctaagatggaagaagatagcagtgacagagaccagggggcacat
ccaaccgctcctagagtggtccgaagatcaagggctcaaagaggaaagtggcttgcaaag
atagatcgtgaaacaggtcctggtgaaacaggtcaagatgataagaagttgaacgcagat
tccatctctaagatggaagaacatgcccatgacaaggatcaagaaccacctccaggtgcc
cagcttatcacattggatgagcaggagcccaaaggaatcaaatcgagtaccacggagaca
ccaagcagcccaaaacacgaacgcaaccaaacagttcttagaagagacaccgctgaaaca
acgagtagcgcaacgtgcgagaagatggaacagatggttgatccgctgcacgcaatgctc
ctggacatgattccatcgcttggccagatgaagacggacgttggtaacagggttgccgaa
gccaaagctgagacgaatccaccttgggtaggaagctccacatccagttacgtggctcca
gtgccacaggcctcagcgagttctgcatccagttctggtgttccggcaccacacgcagga
agctccacacagagtaccggggttccagccccagatccaactgctggtgctccaaagaag
aaaaaggtcagttacaaggacgtcgccggtgcacttctgaaggattggtga

DBGET integrated database retrieval system