KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269289
Entry
9269289           CDS       T01015                                 
Name
(RefSeq) probable aldehyde dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    9269289
   00330 Arginine and proline metabolism
    9269289
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     9269289
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 9269289
NCBI-ProteinID: XP_015639257
UniProt: A0A8J8XEX4 B9FLB9
LinkDB
Position
5:complement(26634842..26640855)
AA seq 550 aa
MSLILSRRRLAAAVRRSGPAALASRWMHTPPFATVSPQEISGSSPAEVQNFVQGSWTTSG
NWNWLVDPLNGEKFIKVAEVQEAEIKPFVESLSNCPKHGLHNPLKAPERYLMYGDISAKA
ANMLGQPVVSDFFAKLIQRVSPKSYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNH
LGQSSNGYRWPYGPVAIITPFNFPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMDQMLRL
LHACGMPAEDVDFINSDGITMNKLLLEANPKMTLFTGSSRIAEKLAADLKGKIKLEDAGF
DWKILGPDVQEVDYIAWVCDQDAYACSGQKCSAQSILFMHKNWSSSGLLDKMKSLSERRK
LEDLTIGPVLTVTTSSMIEHMKNLLKIPGSKVLFGGEPLENHSIPEIYGAFKPTAVFVPL
SEILKSGNFELVTREIFGPFQVVTEYSDDELELVLEACERMNAHLTAAVVSNDPLFLQEV
LGRSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPL
PKNRALPSAT
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgagcctcatcctttcccggcggcgcctcgccgccgccgtccggcggtcaggccccgcc
gcgctcgcctccaggtggatgcacacgccgccattcgcgacggtgtctcctcaggaaatt
tcaggttcgagcccggcggaagtgcagaattttgtgcagggcagttggacaacatctggt
aactggaattggctagttgatcctttaaatggtgaaaaatttatcaaagttgctgaggtt
caggaagcagaaataaagccatttgtagagagtttatctaattgcccaaagcatggactt
cacaacccacttaaagctccagagaggtatctcatgtatggagatatatctgccaaagct
gcaaacatgcttggtcaacctgtggtttcagatttctttgctaaacttatccagagggta
tctccaaagagctatcagcaagctcttgcagaagttcaagtctctcaaaaattcttggag
aacttttgtggagatcaggtacgctttctggctcgatcatttgctgtacctggcaaccat
cttggacaaagcagtaatggttaccgttggccatatggtccggttgcaattatcacaccg
ttcaatttcccattggagattccattactgcaactaatgggagcactgtatatgggaaat
aaacctgtcctcaaagttgacagcaaagttagcattgtgatggaccagatgcttaggttg
cttcacgcatgtgggatgccagcagaggatgtggacttcataaattctgatggtatcacg
atgaacaagctgctgttagaggcaaatccgaaaatgaccctcttcactgggagctcacgg
atagcagagaaattggctgctgatttgaaaggcaaaatcaaattggaagatgctggtttt
gactggaaaattcttggtccagatgttcaagaggttgattacattgcatgggtttgcgac
caggatgcttatgcttgcagtggtcagaagtgctctgctcagtctattctattcatgcac
aagaattggtcgtctagtgggcttcttgataaaatgaaaagtctttctgaaagaaggaag
cttgaagacttgaccattggcccagtccttactgttacaacatcaagcatgatagagcac
atgaaaaaccttctcaaaataccaggatcaaaggtcctgtttggtggtgaacctctggag
aaccattctatcccagaaatatatggtgccttcaaaccaactgctgtatttgttcctcta
tcggaaatccttaaaagtggcaattttgagcttgtgacaagggagatctttggtcctttc
caggtggttacagagtattctgatgatgagcttgaattagtattagaagcctgtgaaagg
atgaacgctcatctgacggctgcagttgtttcaaacgaccctttattcctgcaggaagta
cttgggcgatcagttaacgggacaacatatgccggcatccgagcaaggacaactggtgct
ccacagaaccactggtttgggcctgctggtgatccaagaggtgcagggatcggaactcca
gaagccattaaactcgtttggtcttgccacagggagatcatatatgacattggccccttg
cctaagaaccgggcactaccttccgctacataa

DBGET integrated database retrieval system