KEGG   Phyllostomus discolor (pale spear-nosed bat): 114497212
Entry
114497212         CDS       T07739                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
pdic  Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic00250  Alanine, aspartate and glutamate metabolism
pdic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    114497212 (RIMKLA)
Enzymes [BR:pdic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     114497212 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     114497212 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 114497212
NCBI-ProteinID: XP_028368650
EnsemblRapid: ENSPDIG00005022778
UniProt: A0A6J2LRX4
LinkDB
Position
5:28608223..28642464
AA seq 397 aa
MCSQLWFLTDRRIREDYPQVQILRALQQRCSEQDVRFRAVFMDQIAVTVIGGHLGLQLNQ
KALTTFPDVVLVRVSTPSLQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHQGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYAM
SLLPNMQTGKMAVLPGLSSPREKKEPDGCASAQGVAESIYTINNGSTSSESEPELGEVRG
SSASTSGPPPPTLPTLPTLPEPSYNINNRIASELKLK
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
caaatcctgcgcgccctccagcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ttcatggaccagatcgccgtcaccgtcatcggcggccacctcggcctacagctgaaccag
aaggcgctcaccaccttcccggatgtggtgctcgttcgcgtgtccactccgtcgctgcag
tcagacagtgacatcacggtcctgcggcacctggagaagttgggctgccgcttagtcaac
cgcccacagagcatcttaaactgcatcaacaaattctggaccttccaagagctggctggg
catggggtccccatgccagataccttctcctacggtgggcatgaagacttttcaaagatg
attgatgaagctgagcccctgggctacccggtcgtggtgaagagcacacgaggacaccag
ggaaaagctgtttttcttgcaagagataagcatcacctctcagacatctgtcatctgatc
cgccatgatgtgccctacctgttccagaagtatgtgaaggagtcacacggaaaagatatc
cgggtggtggtggtcgggggccaggtgataggctcgatgcttcgctgctccacggacgga
cggatgcagagcaactgctcccttggtggcgtgggcgtcatgtgcccgctgacagaacag
ggcaagcagctggccattcaggtgtccaacatcctgggcatggacttctgtggcattgac
ctcctcatcatggatgatggctcctttgtggtgtgtgaggcaaatgccaacgtcggtttc
ctcgccttcgaccaggcgtgcaacttagacgtgggcgggatcattgcagactatgccatg
tccttgctgccaaatatgcagactgggaagatggccgtcctcccaggactgtctagtccc
agggagaagaaagagccagacggctgtgcgtcagctcagggagttgcagagagcatctac
accatcaacaacgggtctacctctagtgagagcgagcctgaactgggtgaggtccggggt
tcctccgcgagcacatcagggcccccgccgcccacgctgcccacgctgcccacgctgccc
gaacccagctacaacattaacaacaggattgcttctgaattaaaactgaagtga

DBGET integrated database retrieval system