KEGG   Pseudomonas sp. ATCC 13867: H681_01940
Entry
H681_01940        CDS       T02524                                 
Name
(GenBank) outer membrane protein OprM
  KO
K18139  outer membrane protein, multidrug efflux system
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr02024  Quorum sensing
Module
pdr_M00642  Multidrug resistance, efflux pump MexJK-OprM
pdr_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    H681_01940
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_01940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_01940
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_01940
Transporters [BR:pdr02000]
 Other transporters
  Pores ion channels [TC:1]
   H681_01940
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    H681_01940
   Multidrug resistance, efflux pump MexJK-OprM [MD:M00642]
    H681_01940
   Multidrug resistance, efflux pump MexXY-OprM [MD:M00643]
    H681_01940
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: AGI22270
UniProt: M4XA85
LinkDB
Position
428927..430375
AA seq 482 aa
MRKSLLSLAIAAGVLSGCSLIPDYERPEAPVAGAYPQGDAYVAAQPANAGADIGWREFFK
DPQLQRLIEVSLENNRDLRVAALNIEAYRAQYRIQRADLFPAVDAGINGSRQRLPADLST
TGNSMISSQYGATLGVTSWELDLFGRLRALRDQALETYFASEEARRSTQTSLVANVANAY
LTLRADQAQLKLTRDTLGTYQKSYDLTKRSYDVGVASALDLRQAQTSVESARATLAQYTR
LVAQDQNALVLLLGSGLPADLPQGRELSEELLATVPAGLPSDLLQRRPDILQAEHQLKAA
NANIGAARAAFFPNISLTANAGSLSPDLSGLFDAGSGSWLFQPSISLPIFNAGALRASLD
LAKVQKDINVAQYEKAIQTAFSEVADGLAARGTFGEQLQAQRSLVDASSEYYRLADKRYR
TGVDNYLTLLDAQRSLFSAQQQLISDRLNQLTSEVNLYKALGGGWQATAAEAKPISSEAP
KG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgagaaagtccttactgtccctcgcgatagccgccggcgtgttgtccggctgctcgctg
atccccgactacgagcgccccgaggcgcccgtggcgggggcctatccgcagggcgatgct
tacgtggcggcgcaaccggccaacgccggcgccgacatcggctggcgcgagttcttcaag
gacccgcaactgcagcggctgatcgaagtgtcgctggaaaacaaccgtgacctgcgcgtc
gccgcgctgaacatcgaagcctaccgggcgcagtaccgcatccagcgggccgacctgttc
ccggcggtggacgccggcatcaacggctcgcgccagcgcctgccggccgacctgtcgacc
accggcaactcgatgatcagcagccagtacggcgcgaccctgggcgtcacctcctgggag
ctcgacctgttcggtcgcctgcgcgccctgcgtgaccaggcgctggaaacctacttcgcc
agcgaagaggcccgtcgcagcacccagaccagcctggtggccaacgtcgccaacgcctac
ctgaccctgcgcgccgaccaggctcaactgaagttgacccgcgacaccctgggcacctac
cagaagagctacgacctgaccaagcgcagctacgacgtcggcgtcgcctcggcgctggac
ctgcgccaggcgcagacctcggtggaaagcgcgcgggccaccctggcgcagtacacccgc
ctggtcgcccaggaccagaacgccctggtgctgctgctcggctccggcctgccggcggac
ctgccgcaaggccgcgagctgtccgaagagttgctggccaccgtgccggcagggctgccg
tccgacctgctgcagcgtcgcccggacatcctccaggccgagcatcagctcaaggcggcc
aatgccaacatcggcgcggcgcgcgcggcgttcttcccgaacatcagcctgaccgccaat
gccggcagcctcagcccggacctctccggcctgttcgatgccggctccggcagctggctg
ttccagccgtccatcagcctgccgatcttcaacgccggcgccctgcgcgccagcctggac
ctggccaaggtgcagaaggacatcaacgtggcgcagtacgagaaagccatccagacggcc
ttctccgaggtcgccgacggcctcgccgcccgtggcaccttcggcgagcaactgcaggcg
cagcgctcgctggtggacgccagcagcgagtactaccgcctggccgacaagcgctaccgc
acgggtgtggacaactacctgaccctgctcgatgcgcagcgttcgctgttcagtgcccag
cagcaactgatcagcgaccggctgaaccagctgaccagcgaggtgaacctgtacaaggcc
ctcggcggcggttggcaggccacggcggcggaagcaaagccgatctccagcgaagcgccc
aaaggctga

DBGET integrated database retrieval system