KEGG   Pyrolobus fumarii: Pyrfu_1108
Entry
Pyrfu_1108        CDS       T01620                                 

Name
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K10150  cysteine synthase / O-phosphoserine sulfhydrylase / cystathionine beta-synthase [EC:2.5.1.47 2.5.1.65 4.2.1.22]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00260  Glycine, serine and threonine metabolism
pfm00270  Cysteine and methionine metabolism
pfm00920  Sulfur metabolism
pfm01100  Metabolic pathways
pfm01110  Biosynthesis of secondary metabolites
pfm01120  Microbial metabolism in diverse environments
pfm01230  Biosynthesis of amino acids
Module
pfm_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pyrfu_1108
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pyrfu_1108
   00270 Cysteine and methionine metabolism
    Pyrfu_1108
Enzymes [BR:pfm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Pyrfu_1108
    2.5.1.65  O-phosphoserine sulfhydrylase
     Pyrfu_1108
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     Pyrfu_1108
SSDB
Motif
Pfam: PALP Ribosomal_L31e Syntaxin-5_N
Other DBs
NCBI-ProteinID: AEM38975
UniProt: G0EFF1
LinkDB
Position
complement(1045556..1046755)
AA seq 399 aa
MDYRLVDIRSVKAHRGIDVRNALSSMATILRENRVTRSIVVNDDDVVADEESNILYWSLR
FLGVRRVPVSRGSTVEVNVSLEELGFYEDVNPEPYRVFQDTLELLYRNWPTPLVRLRSLS
GDGYTVWAKLEWYNPYSMSIKDRTAWYMIVRALEEGWRGDKIYEATSTNTGMALAAMGAI
HGFKVKLWIPKSIQKVSDILLKAMGAEVVRRDKSLTVEMISEVKEAASRDNALHIDQFNN
DANFLVHLRFTAKELEVQLKHAGVKLKGIVGGLGTSGHMSAITFYFKTRFDNIKVYGVVP
APGEVIPGIRRPETGMKWVHWSTPDRIVDVKLEEAIEAVLSIARKDGILPGLSSGAVAAA
FMKLRDSGEIEPGHYVLVFPDNGFKYAEQLSAYFAKHGS
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggactataggctcgttgacatcaggtcggtgaaagcgcaccgcggtatcgatgtgaga
aacgcgcttagttcaatggcgactattctccgcgagaatcgcgttacccgaagcatcgtg
gtcaacgacgacgatgtcgtggctgatgaggagtctaacatcctctactggtcgctgagg
tttctcggcgtacgtagagtcccagtgagccgcggcagcacggtagaggttaatgttagc
ctcgaggagcttgggttctacgaggatgttaaccccgagccatatagggtattccaagac
acgcttgagcttctctaccggaactggccgacgccccttgtcaggcttaggagcttatcc
ggtgacggctatacagtatgggctaagctagagtggtacaacccgtatagcatgagcatt
aaggaccgcacagcttggtatatgatagttagggctctcgaggagggatggaggggcgac
aagatctacgaggctacgtcgaccaacactggtatggccctggcggcaatgggagccata
cacggctttaaggttaaactgtggataccgaagagcatacagaaggtgagcgacattctg
ctcaaggctatgggcgccgaggttgtaaggagggataagtcgctaacagtggagatgatc
agcgaggtgaaggaagccgcgagtagggacaatgcactacacatagaccagttcaacaat
gatgcaaacttcctcgtgcatctacgcttcaccgccaaggagcttgaagtgcagctgaag
cacgctggcgttaagctaaagggcatagtcggaggccttggcacatcgggtcacatgagc
gccataacattctacttcaagacgcgattcgacaacatcaaagtgtatggggttgtgcca
gcgccaggcgaggtgataccaggtatacgccgcccagaaaccggaatgaaatgggtacac
tggtcgacgccagaccgtatagttgatgtcaagctcgaagaggctatagaggctgtgttg
agcatcgcaaggaaggatggcatcctgccggggcttagtagtggcgctgtcgcagcagct
ttcatgaagctaagggatagcggagagatagagccgggacactacgtgctagtcttccct
gacaacgggttcaagtatgccgagcaactctcagcctacttcgcgaaacacggttcatag

DBGET integrated database retrieval system