KEGG   Pyrobaculum islandicum: Pisl_1761
Entry
Pisl_1761         CDS       T00444                                 

Name
(GenBank) cysteine synthase
  KO
K10150  cysteine synthase / O-phosphoserine sulfhydrylase / cystathionine beta-synthase [EC:2.5.1.47 2.5.1.65 4.2.1.22]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00260  Glycine, serine and threonine metabolism
pis00270  Cysteine and methionine metabolism
pis00920  Sulfur metabolism
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
pis01120  Microbial metabolism in diverse environments
pis01230  Biosynthesis of amino acids
Module
pis_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:pis00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pisl_1761
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pisl_1761
   00270 Cysteine and methionine metabolism
    Pisl_1761
Enzymes [BR:pis01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Pisl_1761
    2.5.1.65  O-phosphoserine sulfhydrylase
     Pisl_1761
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     Pisl_1761
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: ABL88912
UniProt: A1RVD0
LinkDB
Position
1598617..1599795
AA seq 392 aa
MVWLENIEFVKSDVFYKLSDLLSVAGDILRQGGVVKSIGVDDALRVVEGHEVFHALKLLG
VRRVPISRGRSKEVYVPLETLGFYDDVACPGLRVFDNTVELLYKNWPTPLFKLRSLSRRG
LTVWAKWEAYNPFSWSIKDRVGWYMFTKALEEGRVSQLLYEATSTNTGMTLAAMAAIHGV
RARLYLPSTAQKSSDVWLKTLGAEVVRVSKPLTVDFVGDVEREAARDGAIHLNQFENDRN
FEVHLKYTAKELDLQLRHTGVFPRAIIGGLGTSGHMSALSFYFKNRYRGSVKIYGVQPAV
GHVIPGIRRIETGMKWVHLVELDGVVDITREDAVNAAIEVARKDGILIGLSSGAVASAFL
KIADRLEEGHYILIFPDNGLKYAEIYSTYVKD
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggtttggttagagaacatagagtttgtaaagtctgatgttttttataaactttcagat
ttacttagcgttgctggagatatccttaggcagggtggcgttgttaaatctatcggcgta
gatgacgcgttgagagtggtagagggacatgaggtttttcacgcgcttaagttattggga
gttaggagagtgcctatttctagaggccgatctaaggaggtgtacgtcccgttggagaca
ttgggtttttatgacgatgtggcatgtcccggccttagggtgtttgacaacactgtggag
cttctctataaaaactggcctactccactttttaagctgagatctctgtcgcgtagaggt
ctgactgtatgggctaagtgggaggcgtataatccctttagttggagtataaaagataga
gttggttggtatatgtttacaaaggcgcttgaagaggggagagtttctcagttattatac
gaggccacatcgacaaacaccggcatgactctagccgcaatggcggcaatccacggcgta
agagctaggctctacctcccctctacggcgcagaagtcaagcgatgtttggctaaaaacg
ctgggcgcagaggtggttagagtgtctaagcctttaacggtggatttcgttggcgatgta
gagagggaggccgcaagagatggtgctattcatctgaaccagtttgaaaacgacagaaac
ttcgaggtgcatctgaaatacaccgctaaggagctagatctacagctgagacacactggg
gtttttcccagggctataatcggcggtttaggtacttcgggacatatgtcagctctctcg
ttttatttcaaaaataggtatcgcggctctgtcaaaatatacggcgtacaaccagctgtt
ggacatgtgattccaggtattagacgtatagagacggggatgaagtgggttcatttagtg
gagctagacggcgtagtagatataactagagaagatgctgtcaacgcggcgattgaagtg
gcacgtaaagacggaattttaataggcttaagtagcggcgcagtggcaagcgccttctta
aaaatagccgaccgcctagaggagggacattacatcttaatatttccagacaacggcctt
aaatatgccgaaatttactcaacatatgtaaaagactag

DBGET integrated database retrieval system